Pteropus alecto (black flying fox): 102887980 Help Entry 102887980         CDS       T02993                                  Symbol SST Name (RefSeq) somatostatin   KO K05237   somatostatin Organism pale  Pteropus alecto (black flying fox) Pathway pale04024   cAMP signaling pathway pale04080   Neuroactive ligand-receptor interaction pale04081   Hormone signaling pale04935   Growth hormone synthesis, secretion and action pale04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:pale00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     102887980 (SST)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     102887980 (SST)    04081 Hormone signaling     102887980 (SST)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     102887980 (SST)   09154 Digestive system    04971 Gastric acid secretion     102887980 (SST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pale04052]     102887980 (SST) Cytokines and neuropeptides [BR:pale04052]  Neuropeptides   GPCR binding    102887980 (SST) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Somatostatin NLRC4_HD2 Motif Other DBs NCBI-GeneID:  102887980 NCBI-ProteinID:  XP_006925891 UniProt:  L5JRN5 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search MLSCRLQCALAALSIVLALGGVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEP NQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgctgtcctgccgcctccaatgcgcgctggccgcgctctccatcgtcctggctttgggc ggtgtcactggtgcgccctcggatccccgactccgtcagtttctgcagaagtccctggct gctgccgcagggaagcaggaactggccaagtatttcttggcagagctgctgtctgaaccc aaccagacagagaatgatgccctggaacctgaagatttgtcccaggctgctgagcaggat gaaatgaggctggagctgcagagatctgctaactcaaacccagccatggcaccccgagaa cgcaaagctggctgcaagaatttcttctggaagactttcacatcctgttag

DBGET integrated database retrieval system