Pteropus alecto (black flying fox): 102889892 Help Entry 102889892         CDS       T02993                                  Symbol CCL22 Name (RefSeq) C-C motif chemokine 22   KO K21095   C-C motif chemokine 22 Organism pale  Pteropus alecto (black flying fox) Pathway pale04060   Cytokine-cytokine receptor interaction pale04061   Viral protein interaction with cytokine and cytokine receptor pale04062   Chemokine signaling pathway pale04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:pale00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102889892 (CCL22)    04061 Viral protein interaction with cytokine and cytokine receptor     102889892 (CCL22)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102889892 (CCL22)    04062 Chemokine signaling pathway     102889892 (CCL22)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pale04052]     102889892 (CCL22) Cytokines and neuropeptides [BR:pale04052]  Cytokines   Chemokines    102889892 (CCL22) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  102889892 NCBI-ProteinID:  XP_006908847 UniProt:  L5KW75 LinkDB All DBs Position Unknown AA seq 93 aa AA seqDB search MASLQVPLLAALILLAVAPQTTEAGPYGANVEDSVCCRDYIRYPLPWRVVKYYYWTSNSC RRPGIVLLTGRGRKICADPQIPWVKKILQKLDK NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggctagcctgcaggtcccgctcctggctgccctcatcctccttgctgtggcacctcaa accactgaggcaggcccctacggagccaacgtggaggacagcgtctgctgccgggattac atccgttacccgctgccctggcgtgtggtgaaatattactactggacttcgaactcttgc cggaggcctggcatagtcttgctaaccggtagaggccggaagatctgcgctgacccccaa atcccctgggtgaagaagattctccagaagctggacaagtga

DBGET integrated database retrieval system