Pteropus alecto (black flying fox): 102889931 Help Entry 102889931         CDS       T02993                                  Name (RefSeq) histone H3 isoform X1   KO K11253   histone H3 Organism pale  Pteropus alecto (black flying fox) Pathway pale04613   Neutrophil extracellular trap formation pale05034   Alcoholism pale05202   Transcriptional misregulation in cancer pale05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pale00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102889931  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     102889931   09163 Immune disease    05322 Systemic lupus erythematosus     102889931   09165 Substance dependence    05034 Alcoholism     102889931  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pale03036]     102889931   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pale04147]     102889931 Chromosome and associated proteins [BR:pale03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102889931 Exosome [BR:pale04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102889931 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  102889931 NCBI-ProteinID:  XP_024907952 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcccgtactaagcagactgcccgcaagtcgaccggtggcaaggccccgcgcaagcag ctggccaccaaggcggcccgcaagagcgcgcctgccacgggcggcgtcaagaagccgcac cgctaccggccgggcaccgtggcgctgcgcgagatccgccgctaccagaagtccacggag ctgctgatccgcaagctgcccttccagcgcctggtgcgcgagatcgcgcaggacttcaag accgatctgcgcttccagagctcggccgtcatggcgctgcaggaggccagcgaggcctac ctggtggggctgttcgaggacactaacctgtgcgccatccacgccaagcgcgtcaccatc atgcccaaagacatccagctggcgcgccgcatccgcggggagcgggcctaa

DBGET integrated database retrieval system