Pteropus alecto (black flying fox): 102890061
Help
Entry
102890061 CDS
T02993
Symbol
PSMD7
Name
(RefSeq) 26S proteasome non-ATPase regulatory subunit 7
KO
K03038
26S proteasome regulatory subunit N8
Organism
pale
Pteropus alecto (black flying fox)
Pathway
pale03050
Proteasome
pale05010
Alzheimer disease
pale05012
Parkinson disease
pale05014
Amyotrophic lateral sclerosis
pale05016
Huntington disease
pale05017
Spinocerebellar ataxia
pale05020
Prion disease
pale05022
Pathways of neurodegeneration - multiple diseases
pale05169
Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:
pale00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
03050 Proteasome
102890061 (PSMD7)
09160 Human Diseases
09172 Infectious disease: viral
05169 Epstein-Barr virus infection
102890061 (PSMD7)
09164 Neurodegenerative disease
05010 Alzheimer disease
102890061 (PSMD7)
05012 Parkinson disease
102890061 (PSMD7)
05014 Amyotrophic lateral sclerosis
102890061 (PSMD7)
05016 Huntington disease
102890061 (PSMD7)
05017 Spinocerebellar ataxia
102890061 (PSMD7)
05020 Prion disease
102890061 (PSMD7)
05022 Pathways of neurodegeneration - multiple diseases
102890061 (PSMD7)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03051 Proteasome [BR:
pale03051
]
102890061 (PSMD7)
Proteasome [BR:
pale03051
]
Eukaryotic proteasome
Regulatory particles
PA700 (19S proteasome)
non-ATPase subunits
102890061 (PSMD7)
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
MitMem_reg
JAB
Connexin
Motif
Other DBs
NCBI-GeneID:
102890061
NCBI-ProteinID:
XP_006909880
UniProt:
L5KUR9
LinkDB
All DBs
Position
Unknown
AA seq
322 aa
AA seq
DB search
MPELAVQKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDE
DDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSV
LVIIDVKPKDLGLPTEAYISVEEVHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIK
DTTVGTLSQRITNQVHGLKGLNSKLLDIRSYLEKVATGKLPINHQIIYQLQDVFNLLPDV
SLQEFVKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKIANRDAEKKEGQEKEESKKDR
KDDKEKDKEKSDVKKEEKKEKK
NT seq
969 nt
NT seq
+upstream
nt +downstream
nt
atgccggagctggcggtgcagaaggtggtggtccaccccctggtgctgctcagtgtggtg
gatcatttcaaccgaataggcaaggttggaaaccagaagcgtgttgttggtgtgcttttg
ggatcatggcaaaagaaagtactcgatgtatccaatagttttgcagtaccttttgatgaa
gatgacaaagatgactctgtctggtttttagaccatgattatttggaaaacatgtatgga
atgtttaaaaaggtcaatgccagagaaagaatagttgggtggtaccacacaggccctaaa
ctacacaagaatgacatcgccatcaatgaactcatgaaaagatactgccctaactcagta
ttagtcatcattgacgtgaagccaaaggacctgggactgcccacagaagcatatatttca
gtggaagaagtccatgatgatggaacgccaacttcaaaaacatttgagcatgtgaccagt
gaaattggagcagaggaagctgaggaagttggagtcgaacacttgttacgagacatcaaa
gacactaccgtgggcactctttctcagcggatcacaaaccaggtccatggtttgaaggga
ctgaactccaagcttctggatatcaggagctacttggagaaggtggccacaggaaagctg
cccatcaaccaccagatcatctaccagctacaggacgtcttcaacttgctgccagacgtg
agcctgcaggaatttgtcaaagctttttacctgaagaccaatgaccagatggtagtggtg
tatttggcctccctgatccgttctgtggtcgccctacacaacctcatcaacaacaagatt
gccaaccgggatgcagagaagaaagaagggcaggaaaaagaagagagcaaaaaggataga
aaagatgacaaagagaaagataaggaaaagagtgatgtaaagaaagaagagaaaaaggag
aaaaaataa
DBGET
integrated database retrieval system