Pteropus alecto (black flying fox): 102890357 Help Entry 102890357         CDS       T02993                                  Symbol ARF6 Name (RefSeq) ADP-ribosylation factor 6   KO K07941   ADP-ribosylation factor 6 Organism pale  Pteropus alecto (black flying fox) Pathway pale04014   Ras signaling pathway pale04072   Phospholipase D signaling pathway pale04144   Endocytosis pale04517   IgSF CAM signaling pale04666   Fc gamma R-mediated phagocytosis pale05132   Salmonella infection pale05135   Yersinia infection Brite KEGG Orthology (KO) [BR:pale00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     102890357 (ARF6)    04072 Phospholipase D signaling pathway     102890357 (ARF6)   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     102890357 (ARF6)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102890357 (ARF6)  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     102890357 (ARF6)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102890357 (ARF6)    05135 Yersinia infection     102890357 (ARF6)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pale04131]     102890357 (ARF6)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pale04147]     102890357 (ARF6)    04031 GTP-binding proteins [BR:pale04031]     102890357 (ARF6) Membrane trafficking [BR:pale04131]  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     102890357 (ARF6)   Arf GTPases and associated proteins    Arf GTPases     102890357 (ARF6) Exosome [BR:pale04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102890357 (ARF6)   Exosomal proteins of colorectal cancer cells    102890357 (ARF6) GTP-binding proteins [BR:pale04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     102890357 (ARF6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Arf Roc G-alpha Ras SRPRB Gtr1_RagA MMR_HSR1 GTP_EFTU 6PF2K SpoOE-like CRISPR_Cas2 Motif Other DBs NCBI-GeneID:  102890357 NCBI-ProteinID:  XP_006920271 UniProt:  L5K3E9 LinkDB All DBs Position Unknown AA seq 175 aa AA seqDB search MGKVLSKIFGNKEMRILMLGLDAAGKTTVLYKLKLGQSVTTIPTVGFNVETVTYKNVKFN VWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIF ANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS NT seq 528 nt NT seq  +upstreamnt  +downstreamnt atggggaaggtgctatccaagatcttcgggaacaaggaaatgcggatcctcatgttgggc ctggacgcggccggcaagacaacagtcctgtacaagttgaagctgggccagtcagtgacc accatccccaccgtaggtttcaacgtggagacggtgacttacaaaaacgtcaagttcaac gtgtgggatgtgggcggccaggacaagatccggccgctctggcggcattactacaccggg acccagggtctgatcttcgtggtggactgcgccgaccgcgaccgcatcgacgaggcccgc caggagctgcaccgcattatcaatgaccgggagatgagggacgccataatcctcatcttc gccaacaagcaggacctgcctgatgccatgaaaccccatgagatccaggagaaactgggc ctgacccggattcgggacaggaactggtatgtgcagccttcttgtgccacctcaggggac ggactctatgaggggctcacatggttaacctctaactacaaatcctaa

DBGET integrated database retrieval system