Pteropus alecto (black flying fox): 102890771 Help Entry 102890771         CDS       T02993                                  Symbol IL5 Name (RefSeq) interleukin-5   KO K05428   interleukin 5 Organism pale  Pteropus alecto (black flying fox) Pathway pale04060   Cytokine-cytokine receptor interaction pale04630   JAK-STAT signaling pathway pale04640   Hematopoietic cell lineage pale04657   IL-17 signaling pathway pale04658   Th1 and Th2 cell differentiation pale04660   T cell receptor signaling pathway pale04664   Fc epsilon RI signaling pathway pale04672   Intestinal immune network for IgA production pale05200   Pathways in cancer pale05310   Asthma pale05320   Autoimmune thyroid disease pale05321   Inflammatory bowel disease pale05330   Allograft rejection Brite KEGG Orthology (KO) [BR:pale00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102890771 (IL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102890771 (IL5)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     102890771 (IL5)    04660 T cell receptor signaling pathway     102890771 (IL5)    04658 Th1 and Th2 cell differentiation     102890771 (IL5)    04657 IL-17 signaling pathway     102890771 (IL5)    04664 Fc epsilon RI signaling pathway     102890771 (IL5)    04672 Intestinal immune network for IgA production     102890771 (IL5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102890771 (IL5)   09163 Immune disease    05310 Asthma     102890771 (IL5)    05320 Autoimmune thyroid disease     102890771 (IL5)    05321 Inflammatory bowel disease     102890771 (IL5)    05330 Allograft rejection     102890771 (IL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pale04052]     102890771 (IL5)    00536 Glycosaminoglycan binding proteins [BR:pale00536]     102890771 (IL5) Cytokines and neuropeptides [BR:pale04052]  Cytokines   Interleukins    102890771 (IL5) Glycosaminoglycan binding proteins [BR:pale00536]  Heparan sulfate / Heparin   Cytokines    102890771 (IL5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL5 Motif Other DBs NCBI-GeneID:  102890771 NCBI-ProteinID:  XP_006923213 LinkDB All DBs Position Unknown AA seq 134 aa AA seqDB search MRMLLHLSFLSLGAVYICAIAVESPMNRLVAETLTLLSTHQTLLIGDGNLMIPTPEHKNH QLCIEEVFQGIDTLKNQTAQGDAVEKLFQNLSLIKKYIDSQKKKCEGERWRVKKFLDYLQ VFLGVINTEWTMES NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atgagaatgcttctgcatttgagtttcctatctcttggggctgtctacatttgtgccatt gctgtagaaagtcccatgaatagactggtggcagagaccttgacactgctctccactcat cagactctgctgataggcgatgggaacctgatgattcctactcctgaacataaaaatcac cagttatgcattgaagaagtctttcaggggatagacacattgaagaatcaaactgcgcaa ggggatgccgtggaaaaactattccaaaacttgtctttaataaaaaaatacatagacagc caaaaaaaaaagtgtgaaggagaacgatggagagtaaaaaaattcctagactacctgcaa gtgtttcttggtgtaataaacactgaatggacaatggaaagttga

DBGET integrated database retrieval system