Pteropus alecto (black flying fox): 102890831 Help Entry 102890831         CDS       T02993                                  Symbol CLDN4 Name (RefSeq) claudin-4   KO K06087   claudin Organism pale  Pteropus alecto (black flying fox) Pathway pale03272   Virion - Hepatitis viruses pale04382   Cornified envelope formation pale04514   Cell adhesion molecules pale04530   Tight junction pale04670   Leukocyte transendothelial migration pale05160   Hepatitis C Brite KEGG Orthology (KO) [BR:pale00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     102890831 (CLDN4)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     102890831 (CLDN4)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     102890831 (CLDN4)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     102890831 (CLDN4)   09158 Development and regeneration    04382 Cornified envelope formation     102890831 (CLDN4)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     102890831 (CLDN4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pale03037]     102890831 (CLDN4)    04147 Exosome [BR:pale04147]     102890831 (CLDN4)    04515 Cell adhesion molecules [BR:pale04515]     102890831 (CLDN4) Cilium and associated proteins [BR:pale03037]  Other cilia and associated proteins   Stereociliary proteins    102890831 (CLDN4) Exosome [BR:pale04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    102890831 (CLDN4)   Exosomal proteins of colorectal cancer cells    102890831 (CLDN4) Cell adhesion molecules [BR:pale04515]  Immunoglobulin superfamily   L1 family    102890831 (CLDN4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 TMEM37 DUF4064 DUF7541 Motif Other DBs NCBI-GeneID:  102890831 NCBI-ProteinID:  XP_015450075 UniProt:  L5K5P9 LinkDB All DBs Position Unknown AA seq 209 aa AA seqDB search MASMGLQVMGIALAVLGWLGAILSCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTG QMQCKVHDSMLALPQDLQAARALMVVCIILAVLGVLLSVVGGKCTNCVEDESAKAKTMIV AGVVFLLAGLLVMVPVSWTANTIIRDFYNPLVASGQKREMGASLYVGWAAAGLMMLGGAL LCCNCPPRTDKPYSAKYSAARSAPTSNYV NT seq 630 nt NT seq  +upstreamnt  +downstreamnt atggcctccatggggctacaggtgatgggcattgctctggccgtgctgggctggctggga gccatactgagctgtgcgctgcccatgtggcgggtgacagccttcatcggcagcaacatc gtcacatcccagaccatctgggaaggcctgtggatgaactgcgtggtgcagagcactggc cagatgcagtgcaaggtgcatgactcgatgctggcgctgccacaggacctgcaggcggcc cgtgccctcatggttgtctgcatcatcttggctgtgctgggtgtgctgctgtctgtggtg ggtggcaagtgcaccaactgcgtggaggacgagagcgccaaagccaagaccatgatcgtg gcgggcgtggtgttcctgctggctggcttgctggtgatggtgcccgtgtcctggacggcc aacaccataatccgcgacttctacaacccgctggtggcctctggccagaagagggagatg ggcgcctcgctctacgtgggctgggcagccgcgggcctgatgatgctcggtggcgccttg ctttgctgcaattgcccaccccgcactgacaagccctactcggccaagtactctgccgct cgctcggcccccaccagcaactacgtgtaa

DBGET integrated database retrieval system