Pteropus alecto (black flying fox): 102891351 Help Entry 102891351         CDS       T02993                                  Symbol GSTA4 Name (RefSeq) glutathione S-transferase A4   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism pale  Pteropus alecto (black flying fox) Pathway pale00480   Glutathione metabolism pale00980   Metabolism of xenobiotics by cytochrome P450 pale00982   Drug metabolism - cytochrome P450 pale00983   Drug metabolism - other enzymes pale01100   Metabolic pathways pale01524   Platinum drug resistance pale05200   Pathways in cancer pale05204   Chemical carcinogenesis - DNA adducts pale05207   Chemical carcinogenesis - receptor activation pale05208   Chemical carcinogenesis - reactive oxygen species pale05225   Hepatocellular carcinoma pale05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pale00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     102891351 (GSTA4)   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     102891351 (GSTA4)    00982 Drug metabolism - cytochrome P450     102891351 (GSTA4)    00983 Drug metabolism - other enzymes     102891351 (GSTA4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102891351 (GSTA4)    05204 Chemical carcinogenesis - DNA adducts     102891351 (GSTA4)    05207 Chemical carcinogenesis - receptor activation     102891351 (GSTA4)    05208 Chemical carcinogenesis - reactive oxygen species     102891351 (GSTA4)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     102891351 (GSTA4)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102891351 (GSTA4)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     102891351 (GSTA4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:pale02000]     102891351 (GSTA4) Enzymes [BR:pale01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      102891351 (GSTA4) Transporters [BR:pale02000]  Other transporters   Pores ion channels [TC:1]    102891351 (GSTA4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GST_C_3 GST_C GST_N GST_C_2 GST_N_2 GST_N_3 Motif Other DBs NCBI-GeneID:  102891351 NCBI-ProteinID:  XP_006926883 LinkDB All DBs Position Unknown AA seq 218 aa AA seqDB search MAEKPKLHYPNGRGRMETVRWVLAAAGVEFDEEFLETKEQLQKLQDGNHLLFQQVPMVEI DGMKLVQTRSILHYIADRHHLFGKDLKERTLIDMYVEGTLDLLELIIMHPFLKPDDQQKE VVNMAQKAIIRYFPVFEKVLREHGQRFLVGNQLSLADIILLQTILALEEKIPNILSSFPH LQEYTVKMSNIPTIKKFLEPGSKKKPPPDEIYVRTVYN NT seq 654 nt NT seq  +upstreamnt  +downstreamnt atggcagagaagcccaagctccactatccaaatggaagaggtcggatggaaaccgtaaga tgggttttagctgccgctggagtggagtttgatgaagaatttttagaaacaaaagaacag ttgcagaagttgcaggatggtaaccacctgctgttccaacaagtgccaatggttgaaatt gacgggatgaagttggtgcagacccgaagcattctccactacatagcggacaggcaccat ctctttggcaaggacctcaaggagagaaccctgattgacatgtatgtggaggggacgctg gatctgctggaactgattatcatgcatcctttcctaaaaccagacgatcaacagaaggaa gtggttaacatggctcagaaggctataattagatactttcctgtgtttgaaaaggttcta agggaacatggacaaaggtttcttgttggtaatcagctgagccttgcagatataattcta ctccaaaccattttggctctagaggagaaaattcctaatatcctgtcatcatttcctcac ctccaggagtacacagtgaaaatgagtaatattcccacaattaagaaattccttgaacct ggcagcaagaagaagcctcctccagatgaaatctatgtgagaaccgtttacaac

DBGET integrated database retrieval system