Pteropus alecto (black flying fox): 102891673 Help Entry 102891673         CDS       T02993                                  Name (RefSeq) calmodulin-like   KO K02183   calmodulin Organism pale  Pteropus alecto (black flying fox) Pathway pale04014   Ras signaling pathway pale04015   Rap1 signaling pathway pale04020   Calcium signaling pathway pale04022   cGMP-PKG signaling pathway pale04024   cAMP signaling pathway pale04070   Phosphatidylinositol signaling system pale04114   Oocyte meiosis pale04218   Cellular senescence pale04261   Adrenergic signaling in cardiomyocytes pale04270   Vascular smooth muscle contraction pale04371   Apelin signaling pathway pale04625   C-type lectin receptor signaling pathway pale04713   Circadian entrainment pale04720   Long-term potentiation pale04722   Neurotrophin signaling pathway pale04728   Dopaminergic synapse pale04740   Olfactory transduction pale04744   Phototransduction pale04750   Inflammatory mediator regulation of TRP channels pale04910   Insulin signaling pathway pale04912   GnRH signaling pathway pale04915   Estrogen signaling pathway pale04916   Melanogenesis pale04921   Oxytocin signaling pathway pale04922   Glucagon signaling pathway pale04924   Renin secretion pale04925   Aldosterone synthesis and secretion pale04970   Salivary secretion pale04971   Gastric acid secretion pale05010   Alzheimer disease pale05012   Parkinson disease pale05022   Pathways of neurodegeneration - multiple diseases pale05031   Amphetamine addiction pale05034   Alcoholism pale05133   Pertussis pale05152   Tuberculosis pale05163   Human cytomegalovirus infection pale05167   Kaposi sarcoma-associated herpesvirus infection pale05170   Human immunodeficiency virus 1 infection pale05200   Pathways in cancer pale05214   Glioma pale05417   Lipid and atherosclerosis pale05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pale00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     102891673    04015 Rap1 signaling pathway     102891673    04371 Apelin signaling pathway     102891673    04020 Calcium signaling pathway     102891673    04070 Phosphatidylinositol signaling system     102891673    04024 cAMP signaling pathway     102891673    04022 cGMP-PKG signaling pathway     102891673  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     102891673    04218 Cellular senescence     102891673  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102891673   09152 Endocrine system    04910 Insulin signaling pathway     102891673    04922 Glucagon signaling pathway     102891673    04912 GnRH signaling pathway     102891673    04915 Estrogen signaling pathway     102891673    04921 Oxytocin signaling pathway     102891673    04916 Melanogenesis     102891673    04924 Renin secretion     102891673    04925 Aldosterone synthesis and secretion     102891673   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     102891673    04270 Vascular smooth muscle contraction     102891673   09154 Digestive system    04970 Salivary secretion     102891673    04971 Gastric acid secretion     102891673   09156 Nervous system    04728 Dopaminergic synapse     102891673    04720 Long-term potentiation     102891673    04722 Neurotrophin signaling pathway     102891673   09157 Sensory system    04744 Phototransduction     102891673    04740 Olfactory transduction     102891673    04750 Inflammatory mediator regulation of TRP channels     102891673   09159 Environmental adaptation    04713 Circadian entrainment     102891673  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102891673   09162 Cancer: specific types    05214 Glioma     102891673   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102891673    05163 Human cytomegalovirus infection     102891673    05167 Kaposi sarcoma-associated herpesvirus infection     102891673   09171 Infectious disease: bacterial    05133 Pertussis     102891673    05152 Tuberculosis     102891673   09164 Neurodegenerative disease    05010 Alzheimer disease     102891673    05012 Parkinson disease     102891673    05022 Pathways of neurodegeneration - multiple diseases     102891673   09165 Substance dependence    05031 Amphetamine addiction     102891673    05034 Alcoholism     102891673   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102891673    05418 Fluid shear stress and atherosclerosis     102891673  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pale01009]     102891673   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pale04131]     102891673    03036 Chromosome and associated proteins [BR:pale03036]     102891673   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pale04147]     102891673 Protein phosphatases and associated proteins [BR:pale01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      102891673 Membrane trafficking [BR:pale04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     102891673 Chromosome and associated proteins [BR:pale03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      102891673 Exosome [BR:pale04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    102891673 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_5 EF-hand_6 EF-hand_9 AIF-1 EF_EFCAB10_C SPARC_Ca_bdg EH Temptin_C UPF0154 Dockerin_1 MCM4_WHD FCaBP_EF-hand TerB DUF5580_M WEF-hand SCO1-SenC Spore_III_AB Motif Other DBs NCBI-GeneID:  102891673 NCBI-ProteinID:  XP_024899257 LinkDB All DBs Position Unknown AA seq 148 aa AA seqDB search MAEKLSKEQVADFKAVFTRFDTDGDGNINLQELGDAMRALGQDPTEAELKEIITRVDTDG DGAISLQEFLAEMAKRMKSGIGEQDMREVFRAFDLDGDGHISVDELKQAMAQVGEKLSQE DVEAMIREADLDQDGQVDYEEFARILTR NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atggcagagaagctgtcgaaagagcaggtggctgacttcaaggcggtgttcaccaggttt gacacggacggtgatggcaacatcaacctgcaggagctgggcgacgccatgcgggccctg ggccaggacccgacggaggccgagctgaaggagatcatcacccgggtggacacggacggc gacggcgccatcagcctccaggagttcctggcggagatggccaagaggatgaagtccggc atcggcgagcaggacatgcgggaggtcttccgcgcctttgacctggacggtgacggccac atcagcgtggacgagctcaagcaggccatggcccaggtgggcgagaagctgtcccaggag gacgtggaggccatgatccgagaggctgatttggaccaggacggacaggtggactacgag gagttcgcacgcatcctcacccgctag

DBGET integrated database retrieval system