Pteropus alecto (black flying fox): 102892534 Help Entry 102892534         CDS       T02993                                  Symbol CXCL8 Name (RefSeq) interleukin-8   KO K10030   interleukin 8 Organism pale  Pteropus alecto (black flying fox) Pathway pale04060   Cytokine-cytokine receptor interaction pale04061   Viral protein interaction with cytokine and cytokine receptor pale04062   Chemokine signaling pathway pale04064   NF-kappa B signaling pathway pale04072   Phospholipase D signaling pathway pale04218   Cellular senescence pale04620   Toll-like receptor signaling pathway pale04621   NOD-like receptor signaling pathway pale04622   RIG-I-like receptor signaling pathway pale04657   IL-17 signaling pathway pale04932   Non-alcoholic fatty liver disease pale04933   AGE-RAGE signaling pathway in diabetic complications pale04936   Alcoholic liver disease pale05132   Salmonella infection pale05133   Pertussis pale05134   Legionellosis pale05135   Yersinia infection pale05142   Chagas disease pale05144   Malaria pale05146   Amoebiasis pale05161   Hepatitis B pale05163   Human cytomegalovirus infection pale05164   Influenza A pale05167   Kaposi sarcoma-associated herpesvirus infection pale05171   Coronavirus disease - COVID-19 pale05200   Pathways in cancer pale05202   Transcriptional misregulation in cancer pale05219   Bladder cancer pale05323   Rheumatoid arthritis pale05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pale00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     102892534 (CXCL8)    04072 Phospholipase D signaling pathway     102892534 (CXCL8)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102892534 (CXCL8)    04061 Viral protein interaction with cytokine and cytokine receptor     102892534 (CXCL8)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     102892534 (CXCL8)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102892534 (CXCL8)    04621 NOD-like receptor signaling pathway     102892534 (CXCL8)    04622 RIG-I-like receptor signaling pathway     102892534 (CXCL8)    04657 IL-17 signaling pathway     102892534 (CXCL8)    04062 Chemokine signaling pathway     102892534 (CXCL8)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102892534 (CXCL8)    05202 Transcriptional misregulation in cancer     102892534 (CXCL8)   09162 Cancer: specific types    05219 Bladder cancer     102892534 (CXCL8)   09172 Infectious disease: viral    05161 Hepatitis B     102892534 (CXCL8)    05171 Coronavirus disease - COVID-19     102892534 (CXCL8)    05164 Influenza A     102892534 (CXCL8)    05163 Human cytomegalovirus infection     102892534 (CXCL8)    05167 Kaposi sarcoma-associated herpesvirus infection     102892534 (CXCL8)   09171 Infectious disease: bacterial    05132 Salmonella infection     102892534 (CXCL8)    05135 Yersinia infection     102892534 (CXCL8)    05133 Pertussis     102892534 (CXCL8)    05134 Legionellosis     102892534 (CXCL8)   09174 Infectious disease: parasitic    05146 Amoebiasis     102892534 (CXCL8)    05144 Malaria     102892534 (CXCL8)    05142 Chagas disease     102892534 (CXCL8)   09163 Immune disease    05323 Rheumatoid arthritis     102892534 (CXCL8)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102892534 (CXCL8)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     102892534 (CXCL8)    04932 Non-alcoholic fatty liver disease     102892534 (CXCL8)    04933 AGE-RAGE signaling pathway in diabetic complications     102892534 (CXCL8)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pale04052]     102892534 (CXCL8)    00536 Glycosaminoglycan binding proteins [BR:pale00536]     102892534 (CXCL8) Cytokines and neuropeptides [BR:pale04052]  Cytokines   Chemokines    102892534 (CXCL8) Glycosaminoglycan binding proteins [BR:pale00536]  Heparan sulfate / Heparin   Chemokines    102892534 (CXCL8) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  102892534 NCBI-ProteinID:  XP_006917365 UniProt:  L5K943 LinkDB All DBs Position Unknown AA seq 101 aa AA seqDB search MTSKLAVAFLAAFVLSAALCEAAVLSRISTELRCQCIKTHSAPFHPKFIKELRVIESGPH CAHTEIIVKLVKGNEVCLNPKEKWVQMVVQAFLKRAEKKDP NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgacttccaagctggctgtcgctttcttggccgctttcgtgctttctgcagctctatgt gaagctgcagttctgtcgagaataagcacagaacttcgatgccagtgcataaaaacacat tctgcaccttttcaccccaaatttatcaaagaactgagagtgattgagagtggaccacac tgcgcacatacagaaatcattgtaaagctcgtgaaaggaaatgaggtctgcctgaacccc aaagaaaagtgggtgcagatggttgtgcaggcatttttgaagagagctgagaagaaagat ccatga

DBGET integrated database retrieval system