Pteropus alecto (black flying fox): 102892998 Help Entry 102892998         CDS       T02993                                  Symbol IL1A Name (RefSeq) interleukin-1 alpha   KO K04383   interleukin 1 alpha Organism pale  Pteropus alecto (black flying fox) Pathway pale04010   MAPK signaling pathway pale04060   Cytokine-cytokine receptor interaction pale04217   Necroptosis pale04218   Cellular senescence pale04380   Osteoclast differentiation pale04640   Hematopoietic cell lineage pale04932   Non-alcoholic fatty liver disease pale04933   AGE-RAGE signaling pathway in diabetic complications pale04940   Type I diabetes mellitus pale05010   Alzheimer disease pale05020   Prion disease pale05022   Pathways of neurodegeneration - multiple diseases pale05133   Pertussis pale05140   Leishmaniasis pale05152   Tuberculosis pale05162   Measles pale05164   Influenza A pale05321   Inflammatory bowel disease pale05323   Rheumatoid arthritis pale05332   Graft-versus-host disease pale05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pale00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102892998 (IL1A)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102892998 (IL1A)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     102892998 (IL1A)    04218 Cellular senescence     102892998 (IL1A)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     102892998 (IL1A)   09158 Development and regeneration    04380 Osteoclast differentiation     102892998 (IL1A)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     102892998 (IL1A)    05162 Measles     102892998 (IL1A)   09171 Infectious disease: bacterial    05133 Pertussis     102892998 (IL1A)    05152 Tuberculosis     102892998 (IL1A)   09174 Infectious disease: parasitic    05140 Leishmaniasis     102892998 (IL1A)   09163 Immune disease    05323 Rheumatoid arthritis     102892998 (IL1A)    05321 Inflammatory bowel disease     102892998 (IL1A)    05332 Graft-versus-host disease     102892998 (IL1A)   09164 Neurodegenerative disease    05010 Alzheimer disease     102892998 (IL1A)    05020 Prion disease     102892998 (IL1A)    05022 Pathways of neurodegeneration - multiple diseases     102892998 (IL1A)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102892998 (IL1A)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     102892998 (IL1A)    04932 Non-alcoholic fatty liver disease     102892998 (IL1A)    04933 AGE-RAGE signaling pathway in diabetic complications     102892998 (IL1A)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pale04052]     102892998 (IL1A) Cytokines and neuropeptides [BR:pale04052]  Cytokines   Interleukins    102892998 (IL1A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL1_propep IL1 Motif Other DBs NCBI-GeneID:  102892998 NCBI-ProteinID:  XP_006909521 UniProt:  L5KV65 LinkDB All DBs Position Unknown AA seq 270 aa AA seqDB search MAKVPDVFEDLKNCYSENEEYSSDADQLSLNQKSFYDTSYDTLHEDHGGKLRSLGTSEAS KMSQLTFKESVVVLAADGKVLKKRRLSFDQFITDEDLEAIANDTKEEPIQPHLAPVSFQS SMKYSFMKVIKQQCILSDTLSQSLIRDTSGQYLMAAALNDLNQAVKFDMGAYITDEDSPF PVTLRISETRLFLSAQNEDEPVLLKEMPETPKAIKDETNLLFLWESHGTKNYFKSVAQPK LFIATKQEQLVHMARGQPSITDFQILENRP NT seq 813 nt NT seq  +upstreamnt  +downstreamnt atggccaaggtccccgacgtctttgaagacctgaagaattgttacagtgagaatgaagaa tatagttctgatgctgaccaactctctctgaatcagaaatccttctatgacacaagctac gacacactgcatgaagaccatggaggtaaacttaggtctctgggtacctcagaggcctca aagatgtctcagctcaccttcaaggagagtgtggtggtgctggcagccgacgggaaggtc ctgaagaagaggcgactgagtttcgatcagttcatcaccgatgaagacctggaagccatt gccaacgatacaaaagaagaacccatccagccccatttggcacctgtgagcttccagagc agcatgaagtacagcttcatgaaggtcatcaaacagcagtgcatcctgagtgacacactc agtcagagtctcattcgagatacatcgggtcagtacctcatggcagctgcactaaatgac ctcaaccaagcagtgaaatttgacatgggtgcttacataacagatgaagattctccattt cctgtgactctaagaatctcagaaacacgactctttttgagtgcccaaaacgaagatgag cctgtgctgctgaaggagatgcctgagacacccaaagccatcaaagatgagaccaatctc ctcttcctctgggaaagtcacggcacaaagaactacttcaagtcagtcgcccaaccaaag ctgttcattgccacaaaacaagaacagctggtgcatatggcgagggggcagccctccatc acggactttcagatactggaaaacaggccttga

DBGET integrated database retrieval system