Pteropus alecto (black flying fox): 102893003 Help Entry 102893003         CDS       T02993                                  Symbol POLD4 Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism pale  Pteropus alecto (black flying fox) Pathway pale03030   DNA replication pale03410   Base excision repair pale03420   Nucleotide excision repair pale03430   Mismatch repair pale03440   Homologous recombination Brite KEGG Orthology (KO) [BR:pale00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     102893003 (POLD4)    03410 Base excision repair     102893003 (POLD4)    03420 Nucleotide excision repair     102893003 (POLD4)    03430 Mismatch repair     102893003 (POLD4)    03440 Homologous recombination     102893003 (POLD4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pale03032]     102893003 (POLD4)    03400 DNA repair and recombination proteins [BR:pale03400]     102893003 (POLD4) DNA replication proteins [BR:pale03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     102893003 (POLD4) DNA repair and recombination proteins [BR:pale03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       102893003 (POLD4)    MMR (mismatch excision repair)     DNA polymerase delta complex      102893003 (POLD4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DNA_pol_delta_4 Motif Other DBs NCBI-GeneID:  102893003 NCBI-ProteinID:  XP_006911092 LinkDB All DBs Position Unknown AA seq 182 aa AA seqDB search MFAYLWAGGQASVPGTCGLPLCLSGSSCLPVAGPGLALWPQPSLTLSLSAAVSLVPAGFS PSPQLPPSPPAWVAAMGRKRFITDAFPVVKRREGPAGHCKGKLASELGEEPQPLSVEEVE LELLRQFDLAWQYGPCTGITRLQRWQRAEQMGLEPPPEVRQVLQTHPGDPRFQYSLWHLY PL NT seq 549 nt NT seq  +upstreamnt  +downstreamnt atgtttgcgtacttgtgggcagggggacaggcgtcagtccctggaacctgcggacttcct ctctgcttgtctgggtcatcctgtctgcctgttgctggccccgggcttgctctctggccc cagccctctctcactctctctctctcagcagctgtctctcttgtgcccgctggcttctct ccttccccgcagttgcctccttctccgcctgcctgggtggccgccatgggccggaagcgg ttcattactgatgccttccctgtagtgaagaggagggagggccccgctggacactgcaag gggaagctggcatcagagctaggggaagagccccagcccctgagcgtggaggaagtggag ctggagctgctgaggcagtttgacctggcctggcagtatgggccctgcacagggatcaca cggctgcagcgctggcagcgggcagagcagatgggcttggagcctcccccagaagtacgc caggtgctgcaaacccaccctggagatccccgcttccagtacagcctctggcatctctat cccctctga

DBGET integrated database retrieval system