Pteropus alecto (black flying fox): 102893238 Help Entry 102893238         CDS       T02993                                  Symbol IL1B Name (RefSeq) interleukin-1 beta   KO K04519   interleukin 1 beta Organism pale  Pteropus alecto (black flying fox) Pathway pale01523   Antifolate resistance pale04010   MAPK signaling pathway pale04060   Cytokine-cytokine receptor interaction pale04064   NF-kappa B signaling pathway pale04217   Necroptosis pale04380   Osteoclast differentiation pale04620   Toll-like receptor signaling pathway pale04621   NOD-like receptor signaling pathway pale04623   Cytosolic DNA-sensing pathway pale04625   C-type lectin receptor signaling pathway pale04640   Hematopoietic cell lineage pale04657   IL-17 signaling pathway pale04659   Th17 cell differentiation pale04668   TNF signaling pathway pale04750   Inflammatory mediator regulation of TRP channels pale04932   Non-alcoholic fatty liver disease pale04933   AGE-RAGE signaling pathway in diabetic complications pale04936   Alcoholic liver disease pale04940   Type I diabetes mellitus pale05010   Alzheimer disease pale05020   Prion disease pale05022   Pathways of neurodegeneration - multiple diseases pale05132   Salmonella infection pale05133   Pertussis pale05134   Legionellosis pale05135   Yersinia infection pale05140   Leishmaniasis pale05142   Chagas disease pale05143   African trypanosomiasis pale05144   Malaria pale05146   Amoebiasis pale05152   Tuberculosis pale05162   Measles pale05163   Human cytomegalovirus infection pale05164   Influenza A pale05168   Herpes simplex virus 1 infection pale05171   Coronavirus disease - COVID-19 pale05321   Inflammatory bowel disease pale05323   Rheumatoid arthritis pale05332   Graft-versus-host disease pale05417   Lipid and atherosclerosis pale05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pale00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102893238 (IL1B)    04064 NF-kappa B signaling pathway     102893238 (IL1B)    04668 TNF signaling pathway     102893238 (IL1B)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102893238 (IL1B)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     102893238 (IL1B)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     102893238 (IL1B)    04620 Toll-like receptor signaling pathway     102893238 (IL1B)    04621 NOD-like receptor signaling pathway     102893238 (IL1B)    04623 Cytosolic DNA-sensing pathway     102893238 (IL1B)    04625 C-type lectin receptor signaling pathway     102893238 (IL1B)    04659 Th17 cell differentiation     102893238 (IL1B)    04657 IL-17 signaling pathway     102893238 (IL1B)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     102893238 (IL1B)   09158 Development and regeneration    04380 Osteoclast differentiation     102893238 (IL1B)  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     102893238 (IL1B)    05164 Influenza A     102893238 (IL1B)    05162 Measles     102893238 (IL1B)    05168 Herpes simplex virus 1 infection     102893238 (IL1B)    05163 Human cytomegalovirus infection     102893238 (IL1B)   09171 Infectious disease: bacterial    05132 Salmonella infection     102893238 (IL1B)    05135 Yersinia infection     102893238 (IL1B)    05133 Pertussis     102893238 (IL1B)    05134 Legionellosis     102893238 (IL1B)    05152 Tuberculosis     102893238 (IL1B)   09174 Infectious disease: parasitic    05146 Amoebiasis     102893238 (IL1B)    05144 Malaria     102893238 (IL1B)    05140 Leishmaniasis     102893238 (IL1B)    05142 Chagas disease     102893238 (IL1B)    05143 African trypanosomiasis     102893238 (IL1B)   09163 Immune disease    05323 Rheumatoid arthritis     102893238 (IL1B)    05321 Inflammatory bowel disease     102893238 (IL1B)    05332 Graft-versus-host disease     102893238 (IL1B)   09164 Neurodegenerative disease    05010 Alzheimer disease     102893238 (IL1B)    05020 Prion disease     102893238 (IL1B)    05022 Pathways of neurodegeneration - multiple diseases     102893238 (IL1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102893238 (IL1B)    05418 Fluid shear stress and atherosclerosis     102893238 (IL1B)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     102893238 (IL1B)    04936 Alcoholic liver disease     102893238 (IL1B)    04932 Non-alcoholic fatty liver disease     102893238 (IL1B)    04933 AGE-RAGE signaling pathway in diabetic complications     102893238 (IL1B)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     102893238 (IL1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pale04052]     102893238 (IL1B)    00536 Glycosaminoglycan binding proteins [BR:pale00536]     102893238 (IL1B) Cytokines and neuropeptides [BR:pale04052]  Cytokines   Interleukins    102893238 (IL1B) Glycosaminoglycan binding proteins [BR:pale00536]  Heparan sulfate / Heparin   Cytokines    102893238 (IL1B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL1 IL1_propep Motif Other DBs NCBI-GeneID:  102893238 NCBI-ProteinID:  XP_006909522 UniProt:  L5KTV2 LinkDB All DBs Position Unknown AA seq 267 aa AA seqDB search MAAVPELASEAMAYYSGNENDLFFEADGPTQTKRPFHNLELGSLGDSGIQLQVSPQLCST SPGQVVSVLVALEELRAVPTVCTQDLQEDDLRSLFFFIFEEEPLSCTWDDGYVCDAPLQS LSCRLRDINQKSLVLSGPHELQALHLNRQDASRQVVFCMSFMPGEENDDKIPVALGIKEK NLYLSCVMKDRKPTLQLEMVHPEDQLKKMDKRFVFNKTDIKGKVEFESALYPSWYISTSQ MEQMPVFLGSSRGGQDITDFTLEVLSH NT seq 804 nt NT seq  +upstreamnt  +downstreamnt atggcagcagtgcctgaactcgccagtgaagcgatggcttactacagtggcaatgagaac gacctcttctttgaggctgacggccccacgcagaccaagcgccccttccacaacctggag ctcggctcgctgggcgacagcggcatccagctgcaggtctccccccagctatgcagcaca agtcctgggcaggtggtgtcggtcctggtggctttggaggagctgagggcagtgcccacc gtctgcacacaggacctccaggaggatgacctgagaagtctcttcttcttcatctttgaa gaagagcccctcagctgcacgtgggacgacgggtacgtgtgcgacgcgcccctgcagtcg ctgagctgcaggctccgggacataaaccagaagtccctggtgctatctggaccccacgag ctgcaggccctccacctcaacagacaggatgcaagccgacaagtggtgttctgcatgagc ttcatgccaggagaagagaacgatgacaagatcccagtggccttgggcatcaaggaaaag aacctgtacctgtcctgtgtgatgaaggacaggaagcccactctgcagctggagatggta caccctgaagatcagttaaagaagatggacaagcgatttgtcttcaacaagacagacatc aagggcaaggtggagttcgagtccgccctgtacccaagctggtacatcagtacctcacag atggagcagatgcccgtcttcctggggagcagccgaggtggccaggatataaccgacttc accctggaagtcctttctcactag

DBGET integrated database retrieval system