Pteropus alecto (black flying fox): 102893886 Help Entry 102893886         CDS       T02993                                  Name (RefSeq) interferon alpha-1   KO K05414   interferon alpha Organism pale  Pteropus alecto (black flying fox) Pathway pale04060   Cytokine-cytokine receptor interaction pale04151   PI3K-Akt signaling pathway pale04217   Necroptosis pale04620   Toll-like receptor signaling pathway pale04621   NOD-like receptor signaling pathway pale04622   RIG-I-like receptor signaling pathway pale04623   Cytosolic DNA-sensing pathway pale04630   JAK-STAT signaling pathway pale04650   Natural killer cell mediated cytotoxicity pale04936   Alcoholic liver disease pale05152   Tuberculosis pale05160   Hepatitis C pale05161   Hepatitis B pale05162   Measles pale05163   Human cytomegalovirus infection pale05164   Influenza A pale05165   Human papillomavirus infection pale05167   Kaposi sarcoma-associated herpesvirus infection pale05168   Herpes simplex virus 1 infection pale05169   Epstein-Barr virus infection pale05170   Human immunodeficiency virus 1 infection pale05171   Coronavirus disease - COVID-19 pale05200   Pathways in cancer pale05320   Autoimmune thyroid disease pale05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pale00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102893886    04151 PI3K-Akt signaling pathway     102893886   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102893886  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     102893886  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102893886    04621 NOD-like receptor signaling pathway     102893886    04622 RIG-I-like receptor signaling pathway     102893886    04623 Cytosolic DNA-sensing pathway     102893886    04650 Natural killer cell mediated cytotoxicity     102893886  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102893886   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102893886    05161 Hepatitis B     102893886    05160 Hepatitis C     102893886    05171 Coronavirus disease - COVID-19     102893886    05164 Influenza A     102893886    05162 Measles     102893886    05168 Herpes simplex virus 1 infection     102893886    05163 Human cytomegalovirus infection     102893886    05167 Kaposi sarcoma-associated herpesvirus infection     102893886    05169 Epstein-Barr virus infection     102893886    05165 Human papillomavirus infection     102893886   09171 Infectious disease: bacterial    05152 Tuberculosis     102893886   09163 Immune disease    05320 Autoimmune thyroid disease     102893886   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102893886   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     102893886  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pale04052]     102893886 Cytokines and neuropeptides [BR:pale04052]  Cytokines   Interferons    102893886 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  102893886 NCBI-ProteinID:  XP_006908418 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MALPCSFLVAVVVLSCHSICSLGCDLPQTHSLVNRRALMLLGQMRRISPFSCLKDREDFG FPQGAFGGNQFQEAQAIAVVHEVTRQTFHLFCTEVSSAAWDETLLGRFCTGLYQQLNHLE ACQTQEVGTEETPLLDEDSTLAVRKYFQRITLYLQEKKHSPCAWEIVRAEVMRSYSLSTH FQERSRSKD NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccctgccctgttctttcctggtggctgtggtggtgctcagctgccactccatctgc tctctgggctgtgacctgcctcagacccacagcctggtcaacaggagggcattgatgctc ctgggacaaatgaggagaatctctcctttctcctgcctcaaggacagagaagactttgga ttcccccagggggcgtttggtggcaaccagttccaggaggctcaagccatcgctgtcgtc catgaggtgacccggcagaccttccacctcttctgcacagaggtctcgtccgcagcttgg gatgagaccctgcttggcagattctgcactggactctatcagcagctgaaccacctggaa gcctgtcaaacgcaggaggtggggacggaggagactcccctgctggatgaggactccaca ctggctgtgaggaaatacttccagagaatcaccctctatctgcaggagaagaaacacagc ccttgtgcctgggagattgtcagagcagaggtcatgagatcctactccttatcaacgcac tttcaggaaagatcaaggagtaaggattga

DBGET integrated database retrieval system