Pteropus alecto (black flying fox): 102894382 Help Entry 102894382         CDS       T02993                                  Symbol RAB5B Name (RefSeq) ras-related protein Rab-5B   KO K07888   Ras-related protein Rab-5B Organism pale  Pteropus alecto (black flying fox) Pathway pale04014   Ras signaling pathway pale04137   Mitophagy - animal pale04144   Endocytosis pale04145   Phagosome pale04148   Efferocytosis pale04962   Vasopressin-regulated water reabsorption pale05132   Salmonella infection pale05146   Amoebiasis pale05152   Tuberculosis Brite KEGG Orthology (KO) [BR:pale00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     102894382 (RAB5B)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102894382 (RAB5B)    04145 Phagosome     102894382 (RAB5B)    04137 Mitophagy - animal     102894382 (RAB5B)    04148 Efferocytosis     102894382 (RAB5B)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     102894382 (RAB5B)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102894382 (RAB5B)    05152 Tuberculosis     102894382 (RAB5B)   09174 Infectious disease: parasitic    05146 Amoebiasis     102894382 (RAB5B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pale04131]     102894382 (RAB5B)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pale04147]     102894382 (RAB5B)    04031 GTP-binding proteins [BR:pale04031]     102894382 (RAB5B) Membrane trafficking [BR:pale04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     102894382 (RAB5B)  Endosome - Lysosome transport     102894382 (RAB5B) Exosome [BR:pale04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102894382 (RAB5B)   Exosomal proteins of other body fluids (saliva and urine)    102894382 (RAB5B)   Exosomal proteins of colorectal cancer cells    102894382 (RAB5B)   Exosomal proteins of melanoma cells    102894382 (RAB5B) GTP-binding proteins [BR:pale04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     102894382 (RAB5B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 Gtr1_RagA RsgA_GTPase AAA_16 Motif Other DBs NCBI-GeneID:  102894382 NCBI-ProteinID:  XP_006908939 LinkDB All DBs Position Unknown AA seq 215 aa AA seqDB search MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQ SVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQR QASPSIVIALAGNKADLANKRVVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKK LPKSEPQNLGGAACRSRGVDLHEQSQQNKSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgaccagcagaagcacagccaggcccaatgggcagccccaggctagcaaaatatgccag ttcaaattggtcctgctgggtgaatctgcagtagggaagtctagcctggtattacgtttt gtcaaagggcagttccatgagtaccaggagagcaccattggagcggccttcctcacccag tctgtttgcctagatgacacaacagtcaagtttgagatctgggacacagctgggcaggag cgataccatagcttggcccccatgtactacagaggtgcccaagctgcaattgtggtttat gacattactaatcaggaaactttcgcccgagcgaagacatgggtaaaggaactacagcga caggccagtcctagcatcgttattgccctggcagggaacaaagctgatctggccaacaag cgcgtggtggagtatgaagaggcccaggcatatgcagatgacaacagcttattgtttatg gagacctcagccaagacagctatgaacgtgaatgatctcttcctggcaatagctaagaag ttgccaaagagtgaaccccagaatctggggggtgcagcatgccgaagccgaggtgtggat ctccatgagcagtcccagcagaacaagagccagtgttgtagcaactga

DBGET integrated database retrieval system