Pteropus alecto (black flying fox): 102894694 Help Entry 102894694         CDS       T02993                                  Name (RefSeq) histone H3.3   KO K11253   histone H3 Organism pale  Pteropus alecto (black flying fox) Pathway pale04613   Neutrophil extracellular trap formation pale05034   Alcoholism pale05202   Transcriptional misregulation in cancer pale05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pale00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102894694  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     102894694   09163 Immune disease    05322 Systemic lupus erythematosus     102894694   09165 Substance dependence    05034 Alcoholism     102894694  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pale03036]     102894694   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pale04147]     102894694 Chromosome and associated proteins [BR:pale03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102894694 Exosome [BR:pale04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102894694 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C CENP-S Motif Other DBs NCBI-GeneID:  102894694 NCBI-ProteinID:  XP_006921521 UniProt:  L5JZ83 LinkDB All DBs Position Unknown AA seq 135 aa AA seqDB search MADTKPTASNSTRGKALRKQLATKAPSKSAPSTGEVKKPYCYRPSTIALCEVRRYQKSTE LIRKLSFQHVVREIAQDIKTDLCFQNAAIGALQESSEAYLVGLFEDTNLCDIHAKRVTIM PKGIYLAYRIHGKHA NT seq 408 nt NT seq  +upstreamnt  +downstreamnt atggctgatacaaagccaactgccagcaattccacccgtggtaaagcactgaggaagcaa ctggctacaaaagcccctagcaagagtgcgccctcgactggagaagtaaagaaaccttat tgttacaggcctagtaccatagcactatgtgaagttagacgttatcagaaatccactgaa ctgattcgcaaactttccttccagcacgtggtgcgagaaattgctcaagacatcaaaaca gatctgtgcttccagaatgcagctattggtgctttgcaggagtcaagtgaagcctatctg gttggcctttttgaagacaccaacctgtgtgatatccatgccaagcgtgtaactattatg ccaaaaggcatttacttagcataccgcatacatggaaaacatgcttaa

DBGET integrated database retrieval system