Pteropus alecto (black flying fox): 102895498 Help Entry 102895498         CDS       T02993                                  Symbol ELOB Name (RefSeq) elongin-B   KO K03873   elongin-B Organism pale  Pteropus alecto (black flying fox) Pathway pale04066   HIF-1 signaling pathway pale04120   Ubiquitin mediated proteolysis pale05170   Human immunodeficiency virus 1 infection pale05200   Pathways in cancer pale05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:pale00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     102895498 (ELOB)  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     102895498 (ELOB)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102895498 (ELOB)   09162 Cancer: specific types    05211 Renal cell carcinoma     102895498 (ELOB)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102895498 (ELOB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pale04121]     102895498 (ELOB)    03400 DNA repair and recombination proteins [BR:pale03400]     102895498 (ELOB) Ubiquitin system [BR:pale04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      102895498 (ELOB)    Cul5 complex      102895498 (ELOB) DNA repair and recombination proteins [BR:pale03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      102895498 (ELOB) SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  102895498 NCBI-ProteinID:  XP_015446513 LinkDB All DBs Position Unknown AA seq 113 aa AA seqDB search MIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQ TARPQAPATVGLAFRADDAFEALRIEPFSSPPELPDVMKPQDSGSSANEQAVQ NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atgatccgacgccacaagaccaccattttcacggacgccaaggagtcgagtaccgtgttt gagctgaagcgtatcgtcgagggcattcttaagcggcctcctgacgagcagcggctgtac aaggatgaccagcttctggatgatggcaagacactgggtgagtgtggattcaccagtcag acagcgcgaccgcaggccccagccactgtggggctggccttccgagcagatgatgcattt gaggccctgcgcattgagcccttttccagcccaccagagctgcctgacgtgatgaagcca caggactcaggaagcagcgccaacgaacaagccgtgcagtga

DBGET integrated database retrieval system