Pteropus alecto (black flying fox): 102898108 Help Entry 102898108         CDS       T02993                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism pale  Pteropus alecto (black flying fox) Pathway pale04613   Neutrophil extracellular trap formation pale05034   Alcoholism pale05203   Viral carcinogenesis pale05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pale00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102898108  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     102898108   09163 Immune disease    05322 Systemic lupus erythematosus     102898108   09165 Substance dependence    05034 Alcoholism     102898108  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pale03036]     102898108 Chromosome and associated proteins [BR:pale03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102898108 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  102898108 NCBI-ProteinID:  XP_006919777 UniProt:  L5JWL7 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctgggagaggcaaaggtggcaaaggcttgggtaaaggcggcgccaagcgccaccgc aaagtcctgcgagacaacatccagggcatcaccaagccggccatccggcgcctggcacgg cggggaggggtcaagcgcatctccggcctgatttacgaggagacccggggggtgctgaag gtgttcctggagaacgtgatccgggacgcggtcacctacacggagcacgccaagcgcaag acggtcaccgccatggacgtggtgtacgccctcaagcgtcagggacgcaccctctacggt ttcggaggctaa

DBGET integrated database retrieval system