KEGG   Pteropus alecto (black flying fox): 102898168
Entry
102898168         CDS       T02993                                 
Symbol
MRAP
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04927  Cortisol synthesis and secretion
pale04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:pale00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    102898168 (MRAP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102898168 (MRAP)
SSDB
Motif
Pfam: MRAP Pox_A9 DUF3377 DUF2152
Other DBs
NCBI-GeneID: 102898168
NCBI-ProteinID: XP_006927131
LinkDB
Position
Unknown
AA seq 201 aa
MTLQEISQLASVLRGLGAVLDAPPASAADMANRTNASALYYSFEYYLDYLDLIPVDEKKL
RANKHSIVIIFWVSLAVFVVLLFLVLLYMSWSGSPQVRNNVQHHPACPWSFCLDLPLCIR
RHLLHHRTPRGTLQAPPSSAKEPGSMASGPNQQRQQGSPSAAPPAAPRPTLLSFGNWPLM
GTPVADVGNKTSEPPSRDGTS
NT seq 606 nt   +upstreamnt  +downstreamnt
atgactttacaggaaatttcacagttggccagtgtcctccgaggacttggagcagttctg
gatgctccgcctgccagtgccgcagatatggccaacaggaccaatgcctccgccctgtac
tacagctttgaatactacctggactacctggacctcatccctgtggatgagaagaagctg
agagccaacaaacattcgattgtcatcatcttctgggtgagcctggctgttttcgtggtg
cttctcttcctcgtcctgctctacatgtcctggtcaggctccccgcaggtgaggaacaac
gtccagcaccaccccgcatgcccctggagtttctgcctcgacctccccctgtgcatccgg
aggcacctactgcatcacaggacaccccgggggaccctgcaggctccaccaagctctgcc
aaggaaccaggcagcatggcatctggccccaaccagcagcggcagcaggggagcccctct
gctgcaccccccgccgcccccaggcccaccctgctctcctttgggaactggcccttgatg
gggacccctgtggctgatgtcggcaacaagaccagtgagcctccctctagagacggaacc
tcttga

DBGET integrated database retrieval system