Pteropus alecto (black flying fox): 102898488 Help Entry 102898488         CDS       T02993                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism pale  Pteropus alecto (black flying fox) Pathway pale04137   Mitophagy - animal pale04140   Autophagy - animal pale04144   Endocytosis pale04145   Phagosome pale04148   Efferocytosis pale05132   Salmonella infection pale05146   Amoebiasis pale05152   Tuberculosis Brite KEGG Orthology (KO) [BR:pale00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102898488 (RAB7A)    04145 Phagosome     102898488 (RAB7A)    04140 Autophagy - animal     102898488 (RAB7A)    04137 Mitophagy - animal     102898488 (RAB7A)    04148 Efferocytosis     102898488 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102898488 (RAB7A)    05152 Tuberculosis     102898488 (RAB7A)   09174 Infectious disease: parasitic    05146 Amoebiasis     102898488 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pale04131]     102898488 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pale04147]     102898488 (RAB7A)    04031 GTP-binding proteins [BR:pale04031]     102898488 (RAB7A) Membrane trafficking [BR:pale04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     102898488 (RAB7A) Exosome [BR:pale04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102898488 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    102898488 (RAB7A)   Exosomal proteins of colorectal cancer cells    102898488 (RAB7A)   Exosomal proteins of bladder cancer cells    102898488 (RAB7A) GTP-binding proteins [BR:pale04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     102898488 (RAB7A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_16 AAA_24 G-alpha AAA_5 ATPase_2 NACHT AAA_14 NB-ARC SRPRB ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  102898488 NCBI-ProteinID:  XP_006909101 UniProt:  L5KWL6 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRAKASAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacctctaggaagaaagtgttgctgaaggttatcatcctgggagattctggagtcggt aagacatcactcatgaaccagtatgtgaacaagaaattcagtaatcaatacaaagccaca ataggagcagactttctgacaaaggaggtgatggtggatgacagactagttacaatgcag atctgggacacggcaggacaggaacggttccagtctcttggtgtggccttttatagaggc gcagactgctgtgttctggtatttgatgtgactgccccgaacacattcaaaacccttgat agttggagagatgagtttctcatccaggccagccctcgggatcctgaaaactttcccttt gtagtgttgggaaataagattgacctcgaaaacagacaagtggccacgaagcgagcacag gcctggtgctacagcaaaaacaacattccctactttgagaccagtgccaaggaggccatc aacgtggagcaggccttccagacgattgcacggaatgcacttaaacaggaaacagaggtg gagctgtacaatgaatttcctgaacccatcaaactggacaagaatgaccgggccaaggcc tcggcagaaagctgcagttgctga

DBGET integrated database retrieval system