Pteropus alecto (black flying fox): 102898795 Help Entry 102898795         CDS       T02993                                  Name (RefSeq) histone H3.1   KO K11253   histone H3 Organism pale  Pteropus alecto (black flying fox) Pathway pale04613   Neutrophil extracellular trap formation pale05034   Alcoholism pale05202   Transcriptional misregulation in cancer pale05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pale00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102898795  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     102898795   09163 Immune disease    05322 Systemic lupus erythematosus     102898795   09165 Substance dependence    05034 Alcoholism     102898795  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pale03036]     102898795   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pale04147]     102898795 Chromosome and associated proteins [BR:pale03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102898795 Exosome [BR:pale04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102898795 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-S CENP-T_C PAF CBFD_NFYB_HMF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  102898795 NCBI-ProteinID:  XP_006923340 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKVARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDVQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcccgcaccaagcagacggctcgcaaatccaccggcggaaaggctccgcgtaagcag ttggccactaaagtagctcgcaagagcgcgccagctactggtggggtgaagaaaccacat cgttaccggcctggtacggtagccttacgcgaaatccgtcgctatcagaaatctactgag ctgctgatccgcaaactgcccttccagcgtctggtccgcgagatcgcgcaggatttcaaa accgatctgcgctttcagagctcggctgtgatggctttgcaggaggcatgtgaggcctac ttggtaggactcttcgaggataccaacctgtgtgctatccacgctaagcgcgtcaccatt atgcccaaggatgtccagctggcacgccgcatccgtggggagcgtgcttaa

DBGET integrated database retrieval system