Pteropus alecto (black flying fox): 102898804 Help Entry 102898804         CDS       T02993                                  Name (RefSeq) C-C motif chemokine 3   KO K05408   C-C motif chemokine 3 Organism pale  Pteropus alecto (black flying fox) Pathway pale04060   Cytokine-cytokine receptor interaction pale04061   Viral protein interaction with cytokine and cytokine receptor pale04062   Chemokine signaling pathway pale04620   Toll-like receptor signaling pathway pale05142   Chagas disease pale05163   Human cytomegalovirus infection pale05323   Rheumatoid arthritis pale05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pale00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102898804    04061 Viral protein interaction with cytokine and cytokine receptor     102898804  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102898804    04062 Chemokine signaling pathway     102898804  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     102898804   09174 Infectious disease: parasitic    05142 Chagas disease     102898804   09163 Immune disease    05323 Rheumatoid arthritis     102898804   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102898804  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pale04052]     102898804    00536 Glycosaminoglycan binding proteins [BR:pale00536]     102898804 Cytokines and neuropeptides [BR:pale04052]  Cytokines   Chemokines    102898804 Glycosaminoglycan binding proteins [BR:pale00536]  Heparan sulfate / Heparin   Chemokines    102898804 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  102898804 NCBI-ProteinID:  XP_006924999 LinkDB All DBs Position Unknown AA seq 93 aa AA seqDB search MKVSGAALAVLLCTMALCSQVFSAPYGADTPTSCCFSYISRQFPRKFIADYFETSSQCSK PGVIFQTRRGRQVCADPSEAWVQEYVSDLELNA NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctccggggctgccctcgccgttcttctctgcaccatggccctctgcagccag gtcttctctgcgccatatggcgcggacacaccgacttcctgctgcttctcctatatctcc cggcagtttccacgcaaatttatagccgactattttgagaccagcagccagtgctccaag cccggtgtcatcttccaaaccagaagaggccggcaggtttgtgctgaccccagtgaggcc tgggtccaggaatacgtcagtgatcttgagctgaacgcctga

DBGET integrated database retrieval system