Pteropus alecto (black flying fox): 112473206 Help Entry 112473206         CDS       T02993                                  Name (RefSeq) histone H2B-like   KO K11252   histone H2B Organism pale  Pteropus alecto (black flying fox) Pathway pale04613   Neutrophil extracellular trap formation pale05034   Alcoholism pale05203   Viral carcinogenesis pale05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pale00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     112473206  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     112473206   09163 Immune disease    05322 Systemic lupus erythematosus     112473206   09165 Substance dependence    05034 Alcoholism     112473206  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pale03036]     112473206   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pale04147]     112473206 Chromosome and associated proteins [BR:pale03036]  Eukaryotic type   Nucleosome assembly factors    Histones     112473206 Exosome [BR:pale04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112473206 BRITE hierarchy SSDB OrthologParalogGFIT Other DBs NCBI-GeneID:  112473206 NCBI-ProteinID:  XP_024897600 LinkDB All DBs Position Unknown AA seq 113 aa AA seqDB search MYFICLSGLRLSKKIKTYIPAKKKYDWISSVLGKKRRKKKEAYLGYMGKILKQAHPDFSG CSWVLDALGILEDWRLEWLSLEAVRLSFYNHRRVVTSREILEAVKQRPSWKSF NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atgtacttcatctgcttaagtggcctaagattatctaagaagattaaaacttatatccca gccaaaaagaagtatgactggatcagctcagtccttgggaagaagaggaggaagaagaag gaggcctatttgggttacatgggaaaaatcctaaagcaagcccacccagacttcagtggg tgctcctgggtcttagatgcactgggcattctggaagattggcgactggaatggcttagc ctggaggcggtgaggctgtccttctacaaccacagaagagtcgttaccagcagagagatc cttgaagcagtcaagcaaagaccctcttggaagagtttttga

DBGET integrated database retrieval system