Pantoea alhagi: B1H58_00425 Help Entry B1H58_00425       CDS       T05014                                  Name (GenBank) glutaredoxin   KO K03674   glutaredoxin 1 Organism palh  Pantoea alhagi Brite KEGG Orthology (KO) [BR:palh00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:palh03110]     B1H58_00425 Chaperones and folding catalysts [BR:palh03110]  Protein folding catalysts   Protein disulfide isomerase    B1H58_00425 SSDB OrthologParalogGFIT Motif Pfam:  Glutaredoxin Glrx-like Thioredoxin_2 MDH1B_N Thioredoxin_3 SH3BGR DSBA Motif Other DBs NCBI-ProteinID:  ARJ40608 UniProt:  A0A1W6B0K3 LinkDB All DBs Position 100027..100290 Genome browser AA seq 87 aa AA seqDB search MLAVIFGRPSCPYCVRAKELAEKLTAERDDFNFRYVDIQAEGITKADLEKTVGKPVETVP QIFVDQQHLGGFTDFNAWSKANLGVAL NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgcttgcagtcatttttggtcgccccagctgcccttactgtgtgcgtgcaaaagaactg gcggagaagttgaccgcagagcgtgacgattttaatttccgctacgttgatattcaggcc gaaggcattaccaaagcggacctggaaaaaaccgtgggcaaaccggtagaaactgtcccc cagatttttgtcgatcagcagcatctcggcggtttcactgacttcaacgcgtggagcaaa gcgaacctgggcgtcgcactgtaa

DBGET integrated database retrieval system