Pantoea alhagi: B1H58_01060 Help Entry B1H58_01060       CDS       T05014                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism palh  Pantoea alhagi Pathway palh00190   Oxidative phosphorylation palh01100   Metabolic pathways palh02020   Two-component system Module palh_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:palh00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     B1H58_01060  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     B1H58_01060 Enzymes [BR:palh01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      B1H58_01060 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  ARJ40724 UniProt:  A0A1W6B0Y1 LinkDB All DBs Position complement(233296..233409) Genome browser AA seq 37 aa AA seqDB search MWYFAWILGTLLACAFGIITALALEHVEDSAQQQDKP NT seq 114 nt NT seq  +upstreamnt  +downstreamnt atgtggtattttgcctggattcttggaacgctactggcctgtgccttcgggattatcacc gcgctggcgctggagcatgtagaagatagcgcccagcaacaggataaaccctga

DBGET integrated database retrieval system