Pantoea alhagi: B1H58_19765 Help Entry B1H58_19765       CDS       T05014                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism palh  Pantoea alhagi Pathway palh01100   Metabolic pathways palh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:palh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     B1H58_19765    00074 Mycolic acid biosynthesis     B1H58_19765   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     B1H58_19765 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 HLH EutQ Ribosomal_L50 DUF6952 Motif Other DBs NCBI-ProteinID:  ARJ44061 UniProt:  A0A1W6BAI2 LinkDB All DBs Position complement(4136701..4136937) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIISEQLGVKQEEVTNEKSFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINSHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaatcatctccgagcagcttggcgttaagcag gaagaagtcaccaacgaaaaatctttcgttgaagatcttggcgctgattctcttgatacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaagatcactaccgttcaggctgccattgattacatcaatagccatcaggcctaa

DBGET integrated database retrieval system