Pantoea alhagi: B1H58_19925 Help Entry B1H58_19925       CDS       T05014                                  Name (GenBank) DNA damage-inducible protein I   KO K12149   DNA-damage-inducible protein I Organism palh  Pantoea alhagi Brite KEGG Orthology (KO) [BR:palh00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:palh03400]     B1H58_19925 DNA repair and recombination proteins [BR:palh03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     B1H58_19925 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DinI FlgT_M Lact-deh-memb Cutinase Motif Other DBs NCBI-ProteinID:  ARJ44091 UniProt:  A0A1W6BAL1 LinkDB All DBs Position 4166954..4167199 Genome browser AA seq 81 aa AA seqDB search MRVEVTIAKTTQLPAGAIDALTQELSKRIDKEFPEMANHISVRYASANNLTVMGSGKDAK DRVTEILQETWESADDWFITD NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgcgtgttgaagtaaccatagcgaaaaccactcagctccctgccggcgctatcgatgcg ctgacgcaggaactgtcaaaacgaatcgataaagaatttccggaaatggccaaccatatt tcggtgcgctacgccagcgcgaataacctgaccgtgatgggcagtggtaaagatgccaaa gatcgtgtgaccgagatcctgcaggaaacctgggagagcgccgacgactggtttatcact gactag

DBGET integrated database retrieval system