Pendulispora albinea: LZC94_10140 Help Entry LZC94_10140       CDS       T10974                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism palj  Pendulispora albinea Pathway palj00261   Monobactam biosynthesis palj01100   Metabolic pathways palj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:palj00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     LZC94_10140  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:palj01008]     LZC94_10140 Polyketide biosynthesis proteins [BR:palj01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     LZC94_10140 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WXB17620 UniProt:  A0ABZ2M4X8 LinkDB All DBs Position complement(2501465..2501728) Genome browser AA seq 87 aa AA seqDB search MSTENPTNPTIAKHQASPSEQEDTTIYKVVVNHEEQYSIWPEYRENPLGWRDAGKSGTKA ECLDHIARVWTDMRPLSLRKQMEGQTP NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgagcaccgaaaatccgaccaacccgacgatcgcaaagcaccaggcaagcccgagcgag caggaagacacgacgatctacaaagtcgtggtcaaccacgaggagcagtactcgatctgg cccgagtaccgcgagaaccccctgggctggcgcgacgccggcaagagcggcaccaaggcc gagtgcttggaccatatcgcccgggtttggaccgacatgcgccccctcagcctgcgcaag cagatggaggggcagacgccgtga

DBGET integrated database retrieval system