KEGG   Pendulispora albinea: LZC94_42070
Entry
LZC94_42070       CDS       T10974                                 
Name
(GenBank) AAA family ATPase
  KO
K03924  MoxR-like ATPase [EC:3.6.3.-]
Organism
palj  Pendulispora albinea
Brite
KEGG Orthology (KO) [BR:palj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LZC94_42070
SSDB
Motif
Pfam: bpMoxR AAA_5 AAA_16 AAA AAA_lid_8 Mg_chelatase AAA_7 Rad17 AAA_3
Other DBs
NCBI-ProteinID: WXB14400
UniProt: A0ABZ2LZ66
LinkDB
Position
10735381..10736577
AA seq 398 aa
MSNETSERRRAAENVRRAISEACQGLVDREALVELVVLCAVAGEHLLVIGPPGTAKSEAV
RRIARRLGGAYFEYLIGRFTEPTEIFGPIDLRKLKEGVVETETSGMLPEADIAFLDEVFL
GSTAILNTLLGILNERTFRRGRTALACPLRVCVGASNRLPAEEDQLAAFADRFLVRVFVE
PVRDSALEELLAAGWSLRPSPATVGTAAASLGDLDVLAGAAASMDLSPIRSAIAQGVRLV
REAGIAWTDRRIVRVQGLIAAAAALAGRERPTEADLWPMVFALPSEQAQRAGRDALRELL
SRSENGSLVTAAAEGSLAPEARGAILAKRGAAIVAARPKAEPSDGGHGPWRLQLESVARE
IDATFTADAMPLELVALRARIVQLLGAPEPRGEGARAT
NT seq 1197 nt   +upstreamnt  +downstreamnt
gtgtcgaacgaaacgtcggaacggaggcgcgcggcggagaacgttcgccgcgccatctcc
gaggcatgccaggggctcgtggatcgcgaggcgctcgtggagctggtggtgctctgcgcg
gtcgccggcgagcatctgctggtcatcggccctcccgggacggccaagagcgaggcggtg
cggcgcatcgcgcggcggctcgggggcgcgtacttcgagtacttgatcgggcggttcacc
gaaccgacggagatcttcgggcccatcgatctgcgcaagttgaaggagggcgtggtcgag
accgagacgtcggggatgctccccgaggccgatatcgcgtttttggacgaggtatttctg
gggtcgacggcgatcttgaacacgctgctcggcatcctgaacgagcgaacgtttcgccgc
gggcgaacggcgttggcgtgcccgcttcgggtgtgcgtgggcgcatccaatcggctgccg
gccgaggaggaccagctcgcggcgttcgcggaccgctttttggtgcgggtgttcgtcgag
ccggtgcgcgattcggcgctcgaggaattgctggcggcggggtggtcgctgcgcccttcg
ccggcgacggtggggacggcggccgcgtcgctcggggatctcgatgtgctggcgggggcc
gcggcgagcatggatctgagcccgatccgatcggccattgcgcagggcgtgcgcctcgtg
cgcgaggcggggatcgcgtggacggatcggcgcatcgtgcgggtgcaaggcttgattgcg
gcggcggccgcgctcgccggtcgggagcggccaaccgaggcggatctctggcccatggtg
tttgcgctgccgagcgagcaggcgcagcgcgccgggcgtgatgcgctgcgggagctgctt
tcacggtcggagaatgggagcttggtcacggcggccgcggagggctcgctcgcgcccgag
gcgcgcggcgcgatcctggcgaagcggggtgcggcgatcgtggcggcccggccaaaggcg
gagccgagcgatggcggtcacgggccatggcggctgcagctcgagagcgttgcgcgcgag
atcgacgcgaccttcacggcggatgcgatgcctctggagctcgtcgcgctgcgtgcccgg
atcgtgcagcttttgggggctccggagccgaggggcgaaggcgctcgggcaacctag

DBGET integrated database retrieval system