Pendulispora albinea: LZC94_43970 Help Entry LZC94_43970       CDS       T10974                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism palj  Pendulispora albinea Pathway palj00253   Tetracycline biosynthesis palj01056   Biosynthesis of type II polyketide backbone palj01100   Metabolic pathways palj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:palj00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     LZC94_43970    00253 Tetracycline biosynthesis     LZC94_43970  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:palj01004]     LZC94_43970    01008 Polyketide biosynthesis proteins [BR:palj01008]     LZC94_43970 Lipid biosynthesis proteins [BR:palj01004]  Polyketide synthase   Component type    LZC94_43970 Polyketide biosynthesis proteins [BR:palj01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      LZC94_43970     Nonaketide PKS      LZC94_43970     Decaketide PKS      LZC94_43970 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  WXB14765 LinkDB All DBs Position complement(11219803..11220096) Genome browser AA seq 97 aa AA seqDB search MTTKEFTLEDLEGILLASTGEDKNVHLAAGQIDAAFEELGYDSVTVLEMWRRIELECHIV VDFSVMAEIRTPRAVLHAVDVYLRSSRGADLCLREWH NT seq 294 nt NT seq  +upstreamnt  +downstreamnt gtgactacgaaggaattcaccctcgaagacctcgaagggatcctgctcgccagcacggga gaggacaaaaacgtccatctcgccgccggccagatcgacgccgccttcgaagagctgggc tacgattccgtgacggtgctggaaatgtggcgccggatcgagctcgaatgccatatcgtc gtcgacttctcggtaatggccgaaatacgaacgccgcgcgcggtgctccatgccgtcgac gtctatcttcgctcgagtcgcggagccgacctttgccttcgtgaatggcattga

DBGET integrated database retrieval system