Pseudomonas alkylphenolica: PSAKL28_37900 Help Entry PSAKL28_37900     CDS       T03238                                  Name (GenBank) anti-sigma-28 factor FlgM   KO K02398   negative regulator of flagellin synthesis FlgM Organism palk  Pseudomonas alkylphenolica Pathway palk02020   Two-component system palk02025   Biofilm formation - Pseudomonas aeruginosa palk02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:palk00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     PSAKL28_37900  09140 Cellular Processes   09145 Cellular community - prokaryotes    02025 Biofilm formation - Pseudomonas aeruginosa     PSAKL28_37900   09142 Cell motility    02040 Flagellar assembly     PSAKL28_37900  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:palk02035]     PSAKL28_37900 Bacterial motility proteins [BR:palk02035]  Flagellar system   Flagellar assembly proteins    Others     PSAKL28_37900 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM EAD11 DUF7839 DUF2514 DUF1811 Motif Other DBs NCBI-ProteinID:  AIL62942 UniProt:  A0A077FC42 LinkDB All DBs Position 4161654..4161968 Genome browser AA seq 104 aa AA seqDB search MVIDFSRLNNSPSVAGVRTGNSQESTASNTAAKADSVAQGSASGEAVHLSHEAQQLQKVS DKLRDQPIVNSARVAELKQAIADGSYQVDSNRVASKLLNFEAQR NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atggtcatcgacttcagtcgtttgaataactctccgtcggttgccggcgtgcgtaccggc aacagccaggaaagcactgccagcaacaccgcagccaaggccgattccgtcgcccagggc agcgccagcggggaagccgtacacctcagccacgaggcccagcagttgcaaaaggtcagc gacaagctgcgcgaccagccgattgtcaacagcgcccgggtggcggagttgaagcaggcg atcgccgacggcagctaccaggtcgacagcaaccgcgtcgccagcaaactgcttaatttc gaagctcagcgctag

DBGET integrated database retrieval system