Pseudomonas alkylphenolica: PSAKL28_50550 Help Entry PSAKL28_50550     CDS       T03238                                  Name (GenBank) chromosome segregation ATPase   KO K09892   cell division protein ZapB Organism palk  Pseudomonas alkylphenolica Brite KEGG Orthology (KO) [BR:palk00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:palk03036]     PSAKL28_50550 Chromosome and associated proteins [BR:palk03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     PSAKL28_50550 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ADIP Filament Asd-4 ZapB Motif Other DBs NCBI-ProteinID:  AIL64195 UniProt:  A0A077FI60 LinkDB All DBs Position 5543863..5544072 Genome browser AA seq 69 aa AA seqDB search MQENDLQALMGRFELLIERVEQLKRQNALLLAQEKSWREERAHLIEKNEIARRKVESMIL RLKALEQDS NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgcaagagaacgatctgcaagcgctgatgggccgattcgaactgctgattgagcgagtc gagcaactaaaacggcaaaacgcactcctattagctcaggaaaagtcctggcgcgaggag cgcgcccacctcatcgaaaaaaacgaaatcgcccggcgtaaggtcgaatcgatgattttg cgactcaaggccctggagcaagactcatga

DBGET integrated database retrieval system