Ectopseudomonas alcaliphila: UYA_01520 Help Entry UYA_01520         CDS       T06680                                  Name (GenBank) TIGR02449 family protein   KO K09892   cell division protein ZapB Organism pall  Ectopseudomonas alcaliphila Brite KEGG Orthology (KO) [BR:pall00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pall03036]     UYA_01520 Chromosome and associated proteins [BR:pall03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     UYA_01520 SSDB OrthologParalogGFIT Motif Pfam:  ZapB Matrilin_ccoil Asd-4 ZapB_rel TscT Motif Other DBs NCBI-ProteinID:  APU28461 LinkDB All DBs Position complement(326574..326783) Genome browser AA seq 69 aa AA seqDB search MEDADLHALTAKLELLIQRVEQLKAHNRLLLANEQAWREERAHLIEKNEMARHKVESMIS RLKALEQDS NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggaagacgccgatctgcacgcattgaccgccaagctggaactcttgatccagcgtgtc gagcagctaaaggctcacaaccgactcctgctggcgaatgaacaggcctggcgtgaggag cgcgcccatctgatcgaaaagaacgaaatggcccggcacaaggtcgaatcgatgatttcg cgccttaaagccctggagcaggactcatga

DBGET integrated database retrieval system