Ectopseudomonas alcaliphila: UYA_08455 Help Entry UYA_08455         CDS       T06680                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pall  Ectopseudomonas alcaliphila Pathway pall01100   Metabolic pathways pall01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pall00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     UYA_08455    00074 Mycolic acid biosynthesis     UYA_08455   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     UYA_08455 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 TerB DUF1896 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  APU29760 LinkDB All DBs Position 1839020..1839256 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVTNSASFVEDLGADSLDTVELVMALEEEFETEIPDEQA EKITTVQEAIDYVTAHAQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaaaatcgttgctgagcaacttggcgtcaaggaa gaggaagtaaccaacagcgcttccttcgttgaagacctgggtgccgactctcttgacacc gttgagctggtgatggctctcgaggaagaattcgagaccgagatcccggacgagcaagct gagaaaatcaccaccgttcaagaagctatcgactacgtgactgcccacgcgcaataa

DBGET integrated database retrieval system