Paludihabitans sp. MB14-C6: RBG61_03075 Help Entry RBG61_03075       CDS       T09321                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism palm  Paludihabitans sp. MB14-C6 Brite KEGG Orthology (KO) [BR:palm00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:palm03032]     RBG61_03075    03036 Chromosome and associated proteins [BR:palm03036]     RBG61_03075    03400 DNA repair and recombination proteins [BR:palm03400]     RBG61_03075 DNA replication proteins [BR:palm03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     RBG61_03075 Chromosome and associated proteins [BR:palm03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     RBG61_03075 DNA repair and recombination proteins [BR:palm03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       RBG61_03075 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-CCDC81_euk_2 HU-HIG HU-CCDC81_bac_2 DUF2267 Motif Other DBs NCBI-ProteinID:  WMJ23664 LinkDB All DBs Position complement(647645..647917) Genome browser AA seq 90 aa AA seqDB search MTKVELIAAVAEKAELSKKDAEKAVNATIQAITEGLKNDSKVQLVGFGTFEVRTRAAREG KNPATGEKIKIAASKVPAFKAGKGLKEYVK NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgacaaaagttgaactaattgctgctgttgcagaaaaagctgaattatctaaaaaagat gctgaaaaagcagtaaatgctactatccaagctattacagagggtttgaaaaacgactct aaagttcaattagttggttttggtacttttgaagttcgtactcgtgcagctcgtgaaggt aaaaatcctgctactggcgaaaagattaaaattgctgcttctaaagttccagcattcaaa gctggcaaaggcttaaaagaatacgttaaataa

DBGET integrated database retrieval system