Paracoccus albus: PAF20_00450 Help Entry PAF20_00450       CDS       T09266                                  Name (GenBank) hypothetical protein   KO K02395   peptidoglycan hydrolase FlgJ Organism pals  Paracoccus albus Pathway pals02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:pals00001]  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     PAF20_00450  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:pals02035]     PAF20_00450 Bacterial motility proteins [BR:pals02035]  Flagellar system   Flagellar assembly proteins    Rod and hook     PAF20_00450 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Rod-binding Motif Other DBs NCBI-ProteinID:  WBU60436 LinkDB All DBs Position 93782..94006 Genome browser AA seq 74 aa AA seqDB search MEKLNSMRLNVAIPSQRLQSAFLEQVTQHILPRSDCGYFSGGAGEQHFTSFLNRAYAEAW SSAVDLGVKIGKDD NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggaaaaattaaatagtatgagattaaatgttgcaattccatctcaacggttgcaatcg gcttttttggaacaggtgactcagcatattttgcctcgaagtgattgtggatatttctct ggcggcgctggcgaacaacatttcacctccttccttaacagagcctatgcggaggcttgg tcttctgcggttgatctgggggttaagattggcaaagatgattaa

DBGET integrated database retrieval system