Paracoccus albus: PAF20_17930
Help
Entry
PAF20_17930 CDS
T09266
Symbol
phnC
Name
(GenBank) phosphonate ABC transporter ATP-binding protein
KO
K02041
phosphonate transport system ATP-binding protein [EC:
7.3.2.2
]
Organism
pals
Paracoccus albus
Pathway
pals02010
ABC transporters
Brite
KEGG Orthology (KO) [BR:
pals00001
]
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
PAF20_17930 (phnC)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
pals02000
]
PAF20_17930 (phnC)
Enzymes [BR:
pals01000
]
7. Translocases
7.3 Catalysing the translocation of inorganic anions and their chelates
7.3.2 Linked to the hydrolysis of a nucleoside triphosphate
7.3.2.2 ABC-type phosphonate transporter
PAF20_17930 (phnC)
Transporters [BR:
pals02000
]
ABC transporters, prokaryotic type
Phosphate and amino acid transporters
Phosphonate transporter
PAF20_17930 (phnC)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_tran
RsgA_GTPase
AAA_21
AAA_29
AAA_22
MMR_HSR1
nSTAND1
AAA_16
nSTAND3
DLIC
AAA_25
TsaE
Mg_chelatase
Motif
Other DBs
NCBI-ProteinID:
WBU62293
LinkDB
All DBs
Position
p2:complement(53348..54163)
Genome browser
AA seq
271 aa
AA seq
DB search
MLALNRVAVTYGNGTQALKPTSLKLAQGQFVVLLGRSGAGKSTLIRTLNGLVAPTSGSII
ADGVGSLDGERALRVHRRRTGMIFQQHQLIGRLSALDNVMTGRLGYHSSFRTLFPLPRSD
RQLGLECLARVGLLDKALVRADQLSGGQQQRVGIARALVQQPRLILADEPVASLDPETAV
EVLSQLRHICTTDGITAVISLHQIDLARRFGDRVIAMRDGSVVADASVDELTDQMCASIY
RSEASGRSSQQAHHHSSHSQPQPVAAMEAAL
NT seq
816 nt
NT seq
+upstream
nt +downstream
nt
atgttggctttgaacagggttgccgtgacctatgggaatggcacacaagctctaaaaccg
acctcgctgaagctcgcgcaggggcagtttgtcgtccttttgggccgctctggcgcgggt
aaatccacactcatccgcacccttaacggcttagttgctcctacgtccggttcgattatc
gctgatggcgttggatctctggacggagagcgggcgctccgagtgcaccgcaggcgcacc
gggatgattttccagcagcaccagctcatcgggcgcttgagcgcgcttgataatgtgatg
accggtcgcttgggctatcactcatcctttcgaaccctctttcctcttccgcgttctgac
cggcaacttgggctggaatgtcttgctcgggttggcttgctcgacaaagccttggtgagg
gctgaccagttgtcgggcggccaacagcaacgtgtcggcatcgcccgtgctctggttcag
cagccccgattgatactggctgacgaacctgtggccagcctcgatccggaaacagccgtc
gaagtcctttcgcaactccgccacatttgcacgacggatggcataacggctgtcatcagc
ctgcaccagatcgacttggcgaggcgctttggtgatcgggtcatcgccatgcgtgatggc
tctgtagtcgcagatgcgtccgttgatgaactgacagatcagatgtgcgcctcgatctac
cgcagcgaagcttcaggccggagttcgcagcaagcgcatcaccattcatcccactcccaa
ccacaacctgttgctgccatggaggccgccctatga
DBGET
integrated database retrieval system