Pseudoglutamicibacter albus: CJ193_000085 Help Entry CJ193_000085      CDS       T09091                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism palu  Pseudoglutamicibacter albus Pathway palu00998   Biosynthesis of various antibiotics palu01100   Metabolic pathways palu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:palu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CJ193_000085    00074 Mycolic acid biosynthesis     CJ193_000085   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CJ193_000085 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 Pro_sub2 Motif Other DBs NCBI-ProteinID:  WIK84324 LinkDB All DBs Position complement(13373..13621) Genome browser AA seq 82 aa AA seqDB search MAASKEEILAGLAEIVNEETDIDVEEIQLEKSFTEDLDIDSISMMTIVVEAESKFDVKIP DEEVKNLKTVGDAVDYIEKAQA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggcagcaagcaaggaagagattctcgccggcctggcagagatcgtcaacgaagagacc gacatcgacgttgaagagatccagctcgagaagtccttcaccgaggaccttgacatcgac tcgatctcgatgatgaccatcgttgttgaagctgagtccaagttcgacgtcaagatccca gatgaggaagtaaagaacctcaagactgttggcgacgccgttgactacatcgagaaggct caggcctag

DBGET integrated database retrieval system