Pseudomonas alvandae SWRI17: KSS97_03360 Help Entry KSS97_03360       CDS       T07736                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism palv  Pseudomonas alvandae SWRI17 Pathway palv01100   Metabolic pathways palv01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:palv00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KSS97_03360    00074 Mycolic acid biosynthesis     KSS97_03360   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KSS97_03360 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QXI54008 LinkDB All DBs Position complement(756148..756405) Genome browser AA seq 85 aa AA seqDB search MSDLHRDIKQLIIDALGLEDIGIDDIGDDQTLFGEGLGLDSVDALELGLAIQKKYGIKID ADAKDTRNHFSNVASLAAFVTAKSA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgagcgatctgcaccgtgacatcaaacagctgatcatcgacgccctcggcctggaggac atcggtatcgacgacatcggcgacgatcagaccctgttcggcgaaggtctgggcctggac tcagtggatgccctggagctcggcctggcgatccagaaaaaatatggcatcaagatcgac gccgatgccaaggacacccgtaaccatttcagcaacgtggcaagccttgcggccttcgtc actgcaaaaagcgcctga

DBGET integrated database retrieval system