KEGG   Pseudomonas alvandae SWRI17: KSS97_25380
Entry
KSS97_25380       CDS       T07736                                 
Name
(GenBank) LD-carboxypeptidase
  KO
K01297  muramoyltetrapeptide carboxypeptidase [EC:3.4.17.13]
Organism
palv  Pseudomonas alvandae SWRI17
Brite
KEGG Orthology (KO) [BR:palv00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:palv01002]
    KSS97_25380
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:palv01011]
    KSS97_25380
Enzymes [BR:palv01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.13  muramoyltetrapeptide carboxypeptidase
     KSS97_25380
Peptidases and inhibitors [BR:palv01002]
 Serine peptidases
  Family S66
   KSS97_25380
Peptidoglycan biosynthesis and degradation proteins [BR:palv01011]
 Precursor biosynthesis
  Carboxypeptidase
   KSS97_25380
SSDB
Motif
Pfam: Peptidase_S66 Peptidase_S66C
Other DBs
NCBI-ProteinID: QXI52822
UniProt: A0ABX8QCD8
LinkDB
Position
complement(5685302..5686228)
AA seq 308 aa
MTPHHPVPALPHEGLIAVIAPAGPAPLDTEKAIQWMRARGHELRIFPGVYEKDGYLAGPD
EIRLNDLHAAFADPEINAIICLRGGYGTPRLLDRIDFDLIRRNPKPFVGYSDITALHLAI
SRYAGFVTFHGPLLNADLLGDKEPPTVTSFFSLLRGQLKAGDVLSHPAAYPLTTVEPGIA
HGRLLGGNLSMIAATMGTPYQIDAEGVILFIEDVNEPLYRIDRLLTQLRLAGTLAKLRGV
LVGDVAGVDVEALNRLLKQTFAPLRIPVLSGWRSGHCDPNLTLPMGALVTLDAGEKKLML
EQDVVVSL
NT seq 927 nt   +upstreamnt  +downstreamnt
atgaccccacaccaccccgtcccagcactcccgcacgaaggcctgatcgccgtgatcgcc
cccgccggccccgcacccctggacacggaaaaagccatccaatggatgcgtgcaaggggc
catgaactgcgaatcttcccaggcgtctacgaaaaagacggctacctcgccggccccgac
gaaatccgcctcaatgacctccacgccgccttcgccgacccagaaatcaacgctatcatc
tgcctacgcggcggctacggcaccccccggctgctggatcgcatcgacttcgacctcata
cgccgcaaccccaagccattcgtaggctacagcgacatcaccgccctgcacctcgccatc
agccgctacgcaggcttcgtcaccttccacggcccgctgctaaacgccgacctcctgggc
gacaaggaacccccaaccgtcacctcgttcttcagcctgctacgcggtcaattgaaggcc
ggcgacgtcctgagccatcccgcagcgtacccgctgaccaccgtcgagccgggcatcgcc
catggacgtctgctgggaggcaacctctcgatgatcgccgcgaccatgggcacgccttac
cagatcgacgccgaaggtgtgatcctgttcatcgaagacgtcaacgaacccctgtaccgc
atcgatcgcctgctgacccaattgcgactcgcgggcacgctggcgaagttgcgcggtgta
ttggtgggggacgtggccggggtggatgtcgaagcgttgaaccggttgctcaagcagacc
ttcgcgccgttgcgcatcccagtgttgtctggctggcgcagcgggcactgcgatccgaac
ctgaccttgcccatgggggcgttggtgacgctggatgcgggggagaagaagttgatgttg
gagcaggatgtggtggtcagtctttag

DBGET integrated database retrieval system