Pseudooceanicola algae: PSAL_026940 Help Entry PSAL_026940       CDS       T06943                                  Symbol grxC Name (GenBank) Glutaredoxin 3   KO K03676   glutaredoxin 3 Organism palw  Pseudooceanicola algae Brite KEGG Orthology (KO) [BR:palw00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:palw03110]     PSAL_026940 (grxC) Chaperones and folding catalysts [BR:palw03110]  Protein folding catalysts   Protein disulfide isomerase    PSAL_026940 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin SH3BGR Glrx-like GST_N_3 GST_N_2 Motif Other DBs NCBI-ProteinID:  QPM91441 UniProt:  A0A418SBF4 LinkDB All DBs Position complement(2891238..2891498) Genome browser AA seq 86 aa AA seqDB search MQEIEIYTTRFCGFCHAAKRLLDERGLAYSEIDVTGDSEGRAAMTQRAAGRTSVPQIFVG TTHVGGCDDLYALDSSGKLDSLISGV NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgcaagagatcgagatctacaccacccgcttctgcggcttctgccatgccgccaagcgc ctgcttgacgaaaggggcctggcctattccgagatcgacgtgaccggcgattccgaaggc cgcgcggcgatgacccaacgcgctgcgggccgaacatcggtgccgcagatctttgtcggc acgacccatgtcgggggctgcgatgacctttatgcgctggacagttccggcaagctcgac agcctgatttcaggcgtatga

DBGET integrated database retrieval system