Ponticoccus alexandrii: GQA70_06985
Help
Entry
GQA70_06985 CDS
T08196
Symbol
phnC
Name
(GenBank) phosphonate ABC transporter ATP-binding protein
KO
K02041
phosphonate transport system ATP-binding protein [EC:
7.3.2.2
]
Organism
palx
Ponticoccus alexandrii
Pathway
palx02010
ABC transporters
Brite
KEGG Orthology (KO) [BR:
palx00001
]
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
GQA70_06985 (phnC)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
palx02000
]
GQA70_06985 (phnC)
Enzymes [BR:
palx01000
]
7. Translocases
7.3 Catalysing the translocation of inorganic anions and their chelates
7.3.2 Linked to the hydrolysis of a nucleoside triphosphate
7.3.2.2 ABC-type phosphonate transporter
GQA70_06985 (phnC)
Transporters [BR:
palx02000
]
ABC transporters, prokaryotic type
Phosphate and amino acid transporters
Phosphonate transporter
GQA70_06985 (phnC)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_tran
AAA_22
AAA_21
SMC_N
AAA_16
MMR_HSR1
AAA_29
Dynamin_N
AAA_18
RsgA_GTPase
Adeno_IVa2
AAA_30
DO-GTPase2
Zeta_toxin
nSTAND1
nSTAND3
Cuticle_1
NB-ARC
DUF87
AAA_15
Motif
Other DBs
NCBI-ProteinID:
QRF66079
UniProt:
A0ABX7F6I4
LinkDB
All DBs
Position
complement(1459738..1460559)
Genome browser
AA seq
273 aa
AA seq
DB search
MLQVQTLTKTFGERTAVDRASFSVDQPRMIGVIGRSGAGKSTLLRMLNRLSDATSGTILF
NGRDITALKGSERRKWQSRCAMIFQQFNLVPRMDVVSNVLHGTLNRRSTLATMFNLYPTE
DIHRAIEILDRLGIADQAPKRAEALSGGQQQRVAIARALMQDPAVILADEPIASLDPMNA
QIVMEALRRIHEEDGRMVIANLHTLDTARRYCDRVIGMRDGRIVFDGTPEQLTTGVARDI
YGAGAGFSEAATSTEIATLDRTDAERLKARALA
NT seq
822 nt
NT seq
+upstream
nt +downstream
nt
atgctgcaggttcagactctgaccaagaccttcggcgagcgtaccgccgtcgaccgcgcc
agcttttccgtcgaccaaccgcgcatgatcggcgtcatcgggcgctcgggcgccgggaaa
tcgacgcttctgcggatgctgaaccggctcagcgacgcgaccagcggcacgatcctgttc
aacggacgcgacatcaccgcgctgaaaggctcggagcggcgcaagtggcagtcgcgctgc
gcaatgatcttccagcagttcaacctcgtgccgcgcatggacgtggtgtcgaacgtgctg
cacggcacactgaaccggcgctctacccttgccacgatgttcaacctttacccgacagag
gacatccaccgcgccatcgagatcctcgaccgcctcggcatcgccgatcaggcacccaag
cgggccgaggcgctgtccggcggccagcagcagcgcgtcgccatcgcccgcgccctgatg
caggaccccgccgtgatcctcgccgacgagccgatcgccagccttgatccgatgaacgcg
cagatcgtcatggaggcgctgcgccgcatccacgaagaagacggccgcatggtcatcgcc
aacctgcacacgctggataccgcgcggcgctactgcgaccgggtgatcggcatgcgcgac
gggcgcatcgtcttcgacggcacgcccgaacagctgaccaccggcgtcgcccgcgacatc
tatggtgccggggccggtttctccgaggccgcgacctcgaccgagatcgcaacgctcgac
cggaccgatgccgaacggctgaaagcccgggccctcgcctga
DBGET
integrated database retrieval system