Ponticoccus alexandrii: GQA70_07915 Help Entry GQA70_07915       CDS       T08196                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism palx  Ponticoccus alexandrii Pathway palx01100   Metabolic pathways palx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:palx00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GQA70_07915    00074 Mycolic acid biosynthesis     GQA70_07915   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GQA70_07915 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  QRF66237 LinkDB All DBs Position 1669858..1670091 Genome browser AA seq 77 aa AA seqDB search MSDIADRVKKIVVEHLSVEEEKVTENASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAA ETIQTFGDAVKFISEAQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgcagatcgcgtgaagaagattgtggtcgagcacctgagcgtcgaagaa gagaaggtcaccgagaacgcttcgttcatcgacgacctcggcgccgactcgctcgacacc gtcgagctggtcatggccttcgaggaagagttcggcattgaaatcccggacgacgctgcc gagaccatccagaccttcggcgacgcggtgaagttcatctcggaagcccagtaa

DBGET integrated database retrieval system