Ponticoccus alexandrii: GQA70_11900 Help Entry GQA70_11900       CDS       T08196                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism palx  Ponticoccus alexandrii Pathway palx01100   Metabolic pathways palx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:palx00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GQA70_11900    00074 Mycolic acid biosynthesis     GQA70_11900   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GQA70_11900 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  QRF66954 LinkDB All DBs Position complement(2487069..2487329) Genome browser AA seq 86 aa AA seqDB search MDVKGKVIEIIAEQAMLEPSDVTMESTPEDLGIDSLGLVESIFAIEESFDISVPFNANDP TESDFDISSVGHIVAGIEKLIAEQRA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atggatgtcaaaggcaaggtgatcgagatcatcgccgaacaggcgatgctggagccgtca gacgtcacgatggagagcacgcccgaggatctcgggatcgattcgctgggcctcgtggag tcgatcttcgccatcgaggagagctttgacatctcggtgcccttcaacgccaacgatccc accgagtcggattttgacatctcttcggtcgggcatatcgtggccgggatcgagaagctg atcgccgagcaacgcgcgtga

DBGET integrated database retrieval system