Ponticoccus alexandrii: GQA70_15790 Help Entry GQA70_15790       CDS       T08196                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism palx  Ponticoccus alexandrii Brite KEGG Orthology (KO) [BR:palx00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:palx03032]     GQA70_15790    03036 Chromosome and associated proteins [BR:palx03036]     GQA70_15790    03400 DNA repair and recombination proteins [BR:palx03400]     GQA70_15790 DNA replication proteins [BR:palx03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     GQA70_15790 Chromosome and associated proteins [BR:palx03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     GQA70_15790 DNA repair and recombination proteins [BR:palx03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       GQA70_15790 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-CCDC81_bac_2 HU-HIG PqqD HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  QRF67642 LinkDB All DBs Position complement(3312970..3313260) Genome browser AA seq 96 aa AA seqDB search MATKPMTKTQLVAALAEKMDADKKTAGAALDSIVEIITSEVAAGGAVTLPGVGKIYCKER PERMVRNPATGEQFKKEADKQVKMTIAKALKDSVNG NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atggcgacgaaaccgatgacgaagacccagctggtcgcagcactggccgagaagatggat gcggacaagaagaccgccggcgcggcgctcgactcgattgtcgagatcatcacctcggaa gtggccgcaggcggcgccgtgaccctgccgggcgtcggcaagatctactgcaaggagcgc cccgagcgcatggttcgcaaccccgcgaccggcgagcagttcaagaaggaagccgacaag caggtcaagatgaccatcgctaaggctctgaaggacagcgtcaacggctga

DBGET integrated database retrieval system