KEGG   Populus alba (white poplar): 118029834
Entry
118029834         CDS       T07314                                 
Name
(RefSeq) tubby-like F-box protein 3 isoform X2
  KO
K19600  tubby and related proteins
Organism
palz  Populus alba (white poplar)
Brite
KEGG Orthology (KO) [BR:palz00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:palz03037]
    118029834
   04990 Domain-containing proteins not elsewhere classified [BR:palz04990]
    118029834
Cilium and associated proteins [BR:palz03037]
 Primary cilia and associated proteins
  Other primary cilia associated proteins
   118029834
Domain-containing proteins not elsewhere classified [BR:palz04990]
 Other domain-containing proteins
  Tubby family proteins
   118029834
SSDB
Motif
Pfam: Tub F-box-like F-box DUF3527
Other DBs
NCBI-GeneID: 118029834
NCBI-ProteinID: XP_034889671
LinkDB
Position
10:complement(2682868..2686848)
AA seq 395 aa
MPAIKSIINRSTSHRVVQYSSAPELNLFAAGGVAETTSCWAHLPQELLREVLVRIEESES
SWPPRKNVVACAGVCRSWRHITKDLVKVPELSGKITFPISVKQPGPREQLLQCFIKRCRS
TQTYRLYLSLNNALTEDGKFLLAARKCRRPTCTDYIISLDTDDMSKGSNTYAGKLRSNFI
GTKFTVFDGQPPHAGAKMTKSYSSRLVNLKQVSPRVPTGNYPVANISYELNVLGSRGPRR
MHCIMDAIPAAAIEPGGVAPTQTEFYHHSADFFPSLLFFRSKSNHVERVESFQSGPLSSQ
REGALVLRNKAPRWHEQLQCWCLNFHGRVTVASVKNFQLVASQENGPAGPEHENIILQFG
KVGKDLFTMDYRYPISAFQAFAICLSSFDTKIACE
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgccagcgattaagagcataattaacaggtcaacatcacacagggtggtccagtacagc
tcagcaccggagctgaacctttttgccgctggcggtgttgcagagactacttcatgttgg
gctcatttgccacaagagttgttaagagaagtgcttgttagaatagaagaatcagagagt
agttggccaccaagaaaaaatgtggtggcttgtgctggtgtttgtaggagttggagacat
ataactaaagatttagttaaagtccctgaactctcaggcaaaatcacttttccgatctct
gtcaagcagcctggtccaagggaacaactcctccagtgcttcataaagcgttgcaggtcc
actcaaacgtaccgtctgtatctcagtttaaataatgcattaactgaagacggtaagttc
cttcttgctgcacgcaagtgtagacgccccacctgcacagattatatcatctctctagat
actgatgatatgtcaaagggaagcaatacttatgctgggaaacttagatccaattttata
ggaaccaagttcacagtctttgatgggcagccacctcatgctggagccaagatgacaaaa
agttactcctctaggctggtaaatttgaaacaagtttctccaagggtccctactggcaac
tacccagttgctaacatctcatatgaattaaatgtattgggttccagaggtcctaggaga
atgcattgcattatggacgccatccctgctgctgccattgaacctggtggagtagctccc
acacagaccgagttttatcatcatagtgcagatttctttccatcactcctgtttttccgg
tcaaagtcaaaccatgttgagagggttgagagctttcaatcaggacccttgtccagtcag
agagaaggagctttggtactgagaaacaaggctccaaggtggcatgagcagctccagtgt
tggtgtttgaacttccatggacgagttacagttgcttcagtgaaaaacttccagctggtc
gcttcccaggaaaatggcccagccgggccagaacatgagaatatcatccttcaatttggc
aaagtgggaaaggatttgtttaccatggattaccgttatccaatctctgcattccaagca
tttgcaatttgcctcagtagctttgacaccaaaatagcttgtgaatga

DBGET integrated database retrieval system