Populus alba (white poplar): 118034740 Help Entry 118034740         CDS       T07314                                  Name (RefSeq) uncharacterized protein   KO K09481   protein transport protein SEC61 subunit beta Organism palz  Populus alba (white poplar) Pathway palz03060   Protein export palz04141   Protein processing in endoplasmic reticulum palz04145   Phagosome Brite KEGG Orthology (KO) [BR:palz00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     118034740    04141 Protein processing in endoplasmic reticulum     118034740  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     118034740  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:palz04131]     118034740   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:palz02044]     118034740 Membrane trafficking [BR:palz04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     118034740 Secretion system [BR:palz02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    118034740 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Sec61_beta Motif Other DBs NCBI-GeneID:  118034740 NCBI-ProteinID:  XP_034895992 LinkDB All DBs Position 9:1909392..1910029 Genome browser AA seq 106 aa AA seqDB search MARGASQSQTTSSSSSSRAGVTAPRGSAAATAGMRRRRVVSSGSSSGGGSGSGIGVPGGN MLRFYTDDAPGLKISPTIVLVISLCFIGFVTALHVFGKLYRSKVSP NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atggcgagaggtgcttctcaatcgcaaacgacctcctcttcttcctcttcccgtgctgga gttacggctcctcgcggctccgctgccgccactgctgggatgcgccgccgccgcgtcgta tcctccggatcctcctccggcggtggtagcggtagcggaatcggagtccctggcggcaac atgcttcgattctacaccgatgatgcgccgggcttgaagatctcgcccacgatagtcctg gtgataagtctctgcttcattggctttgtcactgctctccatgtctttggcaagctttat cgcagcaaggttagtccctga

DBGET integrated database retrieval system