Populus alba (white poplar): 118040443 Help Entry 118040443         CDS       T07314                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism palz  Populus alba (white poplar) Pathway palz03083   Polycomb repressive complex palz04120   Ubiquitin mediated proteolysis palz04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:palz00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     118040443    04120 Ubiquitin mediated proteolysis     118040443   09126 Chromosome    03083 Polycomb repressive complex     118040443  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:palz04131]     118040443    04121 Ubiquitin system [BR:palz04121]     118040443    03036 Chromosome and associated proteins [BR:palz03036]     118040443 Membrane trafficking [BR:palz04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     118040443 Ubiquitin system [BR:palz04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      118040443    Cul7 complex      118040443 Chromosome and associated proteins [BR:palz03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      118040443   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      118040443 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ BTB Motif Other DBs NCBI-GeneID:  118040443 NCBI-ProteinID:  XP_034903282 LinkDB All DBs Position 4:18510410..18511859 Genome browser AA seq 161 aa AA seqDB search MSESKKITLKSSDGETFVVDEAVAVESQTIKHMIEDDCADNEIPLPNVTSKILAKVIEYC KKHVEAGSDKDKNVTGVTEKDESLKSWDNEFVKVDQNTLFDLILAANYLNIKGLLDLTCQ TVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE NT seq 486 nt NT seq  +upstreamnt  +downstreamnt atgtcagaatcaaagaagatcactctcaaatcatccgatggcgagacattcgtcgtcgat gaagcggtcgccgtggagtcacaaaccatcaaacacatgattgaagatgactgcgccgat aacgagatcccgttgcctaacgtgacaagcaagattcttgccaaggttatcgagtactgc aagaaacatgtggaagctggttctgataaggataagaatgttacaggtgttactgagaag gatgagtctttgaagagttgggacaacgagtttgtcaaggttgaccaaaataccctcttt gacctcatcctggcagctaactatctgaacatcaagggcttgctagatttgacctgccag actgtggctgacatgatcaaggggaagactccggaagagattcgcaagacatttaacatc aagaatgacttcactccagaggaagaggaggaggtgcgcagggagaaccagtgggcattt gagtga

DBGET integrated database retrieval system