Populus alba (white poplar): 118040453 Help Entry 118040453         CDS       T07314                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism palz  Populus alba (white poplar) Pathway palz04145   Phagosome palz04148   Efferocytosis palz04620   Toll-like receptor signaling pathway palz05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:palz00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     118040453    04148 Efferocytosis     118040453  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     118040453  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     118040453  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:palz04131]     118040453   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:palz04147]     118040453    04031 GTP-binding proteins [BR:palz04031]     118040453 Membrane trafficking [BR:palz04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     118040453  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     118040453   Macropinocytosis    Ras GTPases     118040453  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     118040453 Exosome [BR:palz04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    118040453   Exosomal proteins of other body fluids (saliva and urine)    118040453   Exosomal proteins of colorectal cancer cells    118040453   Exosomal proteins of bladder cancer cells    118040453 GTP-binding proteins [BR:palz04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     118040453 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU AAA_7 Motif Other DBs NCBI-GeneID:  118040453 NCBI-ProteinID:  XP_034903296 LinkDB All DBs Position 4:18438702..18442497 Genome browser AA seq 198 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADIFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL DLRDDKQFFLDHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQP PKQKKKKKRKAHKACSIL NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atgagtgcttcaagattcataaagtgtgtcactgttggtgatggtgctgttggaaagact tgcatgctcatttcctacaccagcaacactttccctactgattatgtgccaaccgtgttt gacaatttcagtgcaaatgtggttgtggatgggagcactgtcaatttagggttgtgggat actgctggccaggaagattacaatagactgaggcctttgagctatcggggggcagacatt ttcctgcttgctttctccctcattagcaaggccagctatgaaaatgttgctaagaaatgg attcctgaattgaggcactatgcacctggtgttccaattattcttgtcgggacaaagctt gatcttcgagatgataaacaattctttttagatcaccccggtgcagtgcccatcaccaca gctcagggtgaggaactgagaaagctaattggggctcctgtttacattgaatgcagttca aaaacacagcagaatgtgaaagctgtctttgatgcagccattaaggtggtcctccagcct cccaagcagaagaagaaaaagaagaggaaggcacataaggcctgctctatactgtga

DBGET integrated database retrieval system