Populus alba (white poplar): 118049322 Help Entry 118049322         CDS       T07314                                  Name (RefSeq) uncharacterized protein   KO K02183   calmodulin Organism palz  Populus alba (white poplar) Pathway palz04016   MAPK signaling pathway - plant palz04070   Phosphatidylinositol signaling system palz04075   Plant hormone signal transduction palz04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:palz00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     118049322    04070 Phosphatidylinositol signaling system     118049322    04075 Plant hormone signal transduction     118049322  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     118049322  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:palz01009]     118049322   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:palz04131]     118049322    03036 Chromosome and associated proteins [BR:palz03036]     118049322   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:palz04147]     118049322 Protein phosphatases and associated proteins [BR:palz01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      118049322 Membrane trafficking [BR:palz04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     118049322 Chromosome and associated proteins [BR:palz03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      118049322 Exosome [BR:palz04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    118049322 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_9 AIF-1 EF-hand_FSTL1 EH SPARC_Ca_bdg EF-hand_EFHB_C SAPC2_N Dockerin_1 EF_EFCAB10_C DUF5580_M YqeY IPT EF-hand_SWAP70_N DUF4891 Sigma54_CBD Motif Other DBs NCBI-GeneID:  118049322 NCBI-ProteinID:  XP_034915186 LinkDB All DBs Position 2:3502254..3503524 Genome browser AA seq 149 aa AA seqDB search MADALAEEQVAEFREILSLIDKDADGLITLEELATIVQSLDRRPTIEEIRDMICEVDIDG NGTLNFEEFLNVMGRKQKENVTEELKEAFKVFDRNQDGYISGSELRQVMMNLGERLTEEE AEQMIREADLDGDGLVSYEEFSRMMAMAV NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcagatgcactggctgaagaacaggttgccgagttccgagagatccttagcttgatt gacaaggacgcagatggtctcattacactggaagaactggcaaccattgtacaatcgctg gatagacgccccacaatagaagaaattcgagacatgatatgtgaagttgatatcgatgga aatgggacattaaattttgaagagttcttgaatgtcatgggaaggaagcagaaggaaaat gttaccgaggaactaaaagaagctttcaaagtttttgataggaaccaggacggatatatt tcgggcagcgagctaagacaagtgatgatgaatttgggagagagactgacagaggaagag gctgaacagatgatcagagaggcagatttggacggtgatggtctagttagttatgaggaa ttttcaaggatgatggcgatggctgtctga

DBGET integrated database retrieval system